KEGG   Xanthomonas campestris pv. campestris B100: xccb100_3589Help
Entry
xccb100_3589      CDS       T00759                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    xccb100_3589 (rbsK)
Enzymes [BR:xca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     xccb100_3589 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4059498..4060454
Genome map
AA seq 318 aa AA seqDB search
MSSVVVVGSFNVDHVWRCDALPAPGATIAGRYSTGPGGKGFNQAVAAARAGAKTHFLCAL
GDDAGGALARSLAAQDGFALIAEPSNEPTGTGGIYVDAHGRNTIVIGAGANSVLSAGFVD
NQRALVTSARVLLAQLESPAETVESALALARECGVLTVLNAAPANAPTSISLLKLSDVLT
PNETEFAALLGRHVGERINADDVAALDGNTLHSLCRKLLPGGTVVVTLGAVGAFISHAEE
QLRGDTQAHYRVGAESAQTVDTTGAGDAFNGALVASLAHSPNASFITHVRFATRYAARST
EVEGAATSMPRMVPEPAV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggtcgtcgttgtcgggtccttcaatgtcgatcacgtgtggcgctgtgatgcc
ctgcccgcgccgggcgccaccatcgccggtcgctacagcactggtcccggcggcaagggg
ttcaaccaggccgttgcagccgcacgtgccggcgccaagacgcacttcctgtgcgcgctg
ggcgacgatgccggcggtgcactggcgcgttcgctggccgcgcaagacgggtttgcgctg
atcgccgagcccagcaatgagcccaccggcaccggcggcatctatgtcgacgcgcatggc
cgcaacaccatcgtgatcggtgccggcgccaattcggtgctgagcgccgggtttgtcgac
aaccagcgcgcgctggtgacctcggcgcgcgtgctgctggcgcagctggaatcgccggcc
gaaacggtggaatcggcgctggcgctggcacgcgaatgcggtgtgctcaccgtgctcaac
gccgcgccggccaacgcgccgacctcgatcagcctgctcaagctctccgacgtattgacg
ccgaacgaaaccgagtttgctgcgctgctcggccgccacgttggcgagcgcatcaacgcc
gacgatgtggcggcgctggacggcaatacgctgcattcgctgtgccgcaagctgctgccg
ggcggcaccgtggtggtgacgctgggtgcggtgggcgccttcatttcgcacgccgaagaa
cagctgcgcggcgacacccaggcgcattaccgcgtgggcgcggaaagcgcgcagacggtg
gataccaccggtgctggcgatgccttcaacggcgcgctggtggcttcgctggcgcactcg
cccaatgcaagcttcatcacccacgtgcgctttgccacgcgctacgccgcacgctccacc
gaagtggaaggcgcggcgacctcaatgccgcgcatggtgcccgaaccggcggtgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system