KEGG   Xanthomonas campestris pv. campestris B100: xccb100_3609Help
Entry
xccb100_3609      CDS       T00759                                 

Gene name
gpm2
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    xccb100_3609 (gpm2)
   01230 Biosynthesis of amino acids
    xccb100_3609 (gpm2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    xccb100_3609 (gpm2)
  Energy metabolism
   00680 Methane metabolism
    xccb100_3609 (gpm2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    xccb100_3609 (gpm2)
Enzymes [BR:xca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     xccb100_3609 (gpm2)
Exosome [BR:xca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   xccb100_3609 (gpm2)
  Exosomal proteins of melanoma cells
   xccb100_3609 (gpm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4087970..4088557
Genome map
AA seq 195 aa AA seqDB search
MQQRALHFDQVHVSTLERAQATAAIILHDVAPMPEVVSSAALVERNFGIFAGKNKTLIKK
SVGHAVFERYFHDADGAPPDGEHWMDMYARCKTYYETVLAPLDQQAKHVLVVAHKYIVEV
LALIASGLPPAEYIDFRLPNSRPLSWDELKQLTARSSSHLNTLGELTEIHLLRWMLLATL
GGLHCRAWAQRCHLR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcaacgcgcactgcacttcgaccaggtgcatgtctccacgctggagcgcgcgcag
gcaacggcagccatcatcctgcatgacgttgcgcccatgcccgaggtcgtttccagcgcg
gcactggtggaacgcaacttcggcatcttcgccggcaagaacaagaccttgatcaagaag
tcggtcggccatgcggtgtttgaacgctacttccatgatgccgatggcgcgccaccggac
ggcgaacactggatggatatgtacgcccgctgcaagacctactacgagaccgtgctggcg
ccgctggatcagcaagccaagcacgtgctggtcgtcgcgcacaaatacatcgtggaagtc
ttagcgctgatcgcatccgggctgccgccagcggagtacatcgacttccgcttgcccaac
tcgcgcccgctgtcatgggacgaactcaagcaactgaccgcgcgcagttcgtcacacctc
aatacgctgggcgaattgacggaaatccacctgctgcgctggatgctgctcgccacgctc
ggtggtttgcactgtcgtgcatgggcgcagcgctgccacctgcgttag

DBGET integrated database retrieval system