KEGG   Xanthomonas campestris pv. campestris B100: xccb100_3699Help
Entry
xccb100_3699      CDS       T00759                                 

Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xca  Xanthomonas campestris pv. campestris B100
Brite
Enzymes [BR:xca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     xccb100_3699
Secretion system [BR:xca02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   xccb100_3699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4197635..4198429)
Genome map
AA seq 264 aa AA seqDB search
MYRLAIAALLGAISLTACAQSSQPAASNTAAKPAAAPASGNVDQRVGAALKALDPDFKPD
YIGAAPFPGFREVVVGGQVLYVSDDGRYLIQAQPFDIQNKQFAASEGLLAYRRKQLQTVP
KADRIVFAPANPKYTVTVFTDVECGYCRKLHSEIGELNKQGIAVEYLAFPRMGLGSQDHK
EMIAVWCAADRKQALTAAKSGQPVNAKDCKNPVSMEYTLGQRLGVNGTPAIFAPDGTQLG
GYLPPAQLREALEKRAVTTAGGSR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtcttgccatcgccgcattgctcggcgcgatcagccttaccgcctgcgcgcag
tcttcgcagccggccgcgagcaacaccgccgccaagcctgccgccgcaccggcctcgggc
aatgtggaccagcgcgtgggcgccgcgctcaaggcgctggacccggacttcaagccggac
tacatcggcgcggccccgttcccgggcttccgcgaagtggtcgtcggcgggcaggtgctg
tacgtcagcgatgacggccggtacctgatccaggcgcagccgttcgacatccagaacaag
cagttcgccgccagcgagggcctgctggcctaccgccgcaagcagctgcagaccgttccc
aaggctgaccgcatcgtgttcgcgccggccaacccgaagtacaccgtgacggtgttcacc
gatgtggaatgcggctactgccgcaagctgcacagcgagatcggtgaactcaacaagcag
ggcatcgcggtggaatacctggccttcccgcgcatgggcctgggcagccaggaccacaag
gaaatgatcgcggtgtggtgcgcagccgaccgcaagcaggcgctcactgcggccaagtcc
ggccagccggtcaacgccaaggactgcaagaacccggtgtcgatggagtacaccctgggc
cagcgcctgggcgtcaacggcaccccggcgatcttcgcgcccgacggcacccagctgggt
ggctacctgccgccggcacagctgcgcgaagcgctggaaaagcgcgcggtcaccacagcg
ggcggcagccgctaa

DBGET integrated database retrieval system