KEGG   Xanthomonas campestris pv. campestris B100: xccb100_3706Help
Entry
xccb100_3706      CDS       T00759                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xca00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:xca00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:xca03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:xca03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xca03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4204538..4204963
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLDEPLRLVCELARKANDANLSTLILARDAAQAEALDDLLWAFDDEA
YVPHQIAGTDEEDELAPVLIATPEFAAPSRPLVINLRDDPYLGACDRVLEVVPADPAARE
PLRERWKQYKALGLELTKYDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccgacttttacctgatcgccaaaccgcgcttcctcgacgaaccgctgcgg
ctggtctgcgagctggcgcgcaaggccaacgatgccaacctgtccacgctgatcctggcg
cgcgatgccgcacaggccgaggcgctggatgacctgttgtgggcgttcgacgacgaagcc
tatgtgccgcaccagatcgccggcaccgatgaggaagacgaactggcgccggtgctgatc
gcaacgcccgagttcgccgcgccctcgcgcccgctggtgatcaacctgcgcgacgacccg
tacctgggcgcctgcgaccgcgtgctggaagtggtgcccgccgaccccgccgcccgcgaa
ccgctgcgcgaacgctggaagcagtacaaggccctgggcctggaactcacgaaatacgac
atgtag

DBGET integrated database retrieval system