KEGG   Xanthomonas campestris pv. campestris B100: xccb100_4009Help
Entry
xccb100_4009      CDS       T00759                                 

Definition
disulfide-isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
xca  Xanthomonas campestris pv. campestris B100
Brite
Enzymes [BR:xca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     xccb100_4009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4534186..4535763
Genome map
AA seq 525 aa AA seqDB search
MKLSCRRPRPLSIALLAVLATLTACDKPTPSAHAQASPTAAPAAHAGIAWREGGLEAAFA
EARDSGKPILLYWGAAWCAPCNRLKATLFQDPAFIAQTRHFVAVHLDGDAEGTLDWGERF
GIKGYPTIIVLRSDRSEVTRLAGNSDTARLADVLRVVATSTTTVKQLLDKAQHAPQELSA
DDWAVLGNYGWGMDDSLVKSGELPALLARLSERAPQPSLRRRFALAAIVAPEDPPTPSPA
NRAVLEAILADPAEVRANLSTLNYVPAWLVKAGSTDAGQRARLSAKLDQALDAVYADPGV
PINDRLETAFAKIELARLAQGQPTETAPKEPQPPLPAAVVETVHQRVQTIVAAARTAEEH
QSITDSAAALLSEVGDSSGAEQLLLAEVGRSKTPYYYMPRLSQLAEERGDRKTALSWLKK
NYTTASSPVARAQSGARYADGLIRLSPEDSAAIEAVATQAIGALAAQSDADRQRSRKRFA
RLGSALKTWSKQHQQEGTAVLARLRQKMQASCGGKNTSECTSWLS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtcctgccgacgcccgcgcccgctgtcgatcgcactgctggcggtactggca
accctgaccgcctgcgacaagcccacgccgtcggcgcacgcgcaggccagtcccaccgcc
gcgcccgcagcgcacgccggcattgcctggcgcgaaggcgggctcgaagcggcgtttgcc
gaagccagggacagcggcaagccgatcctgctgtactggggcgcggcatggtgcgcgccg
tgcaaccgcctgaaggccaccttgttccaggatccggcgttcatcgcgcagacgcggcac
ttcgtggcagtgcatctggatggcgatgcggaaggcacgctggactggggtgaacgcttc
ggcatcaagggctacccgaccatcatcgtgctgcgttcggaccgcagcgaagtcacccgc
ctggctggcaacagcgacaccgcgcgcctggccgatgtcctgcgggtggtcgccaccagt
accaccaccgtcaaacaactgctggacaaggcgcagcatgccccgcaggaactgagtgcg
gacgactgggccgtcctcggcaactatggctggggcatggacgacagtctggtcaagtcc
ggcgagctgcctgccctgttggcacgcttgtccgaaagagcgccgcaaccgagcttgcgg
cgccgttttgcgctggcggcgatcgtcgcaccggaggacccgcccactcccagtcctgcc
aatcgcgccgtgctggaagcgattctggccgatccggccgaagtgcgagccaatctgagc
acgctgaattacgtgcccgcatggctggtcaaggcgggcagcaccgatgccggccaacgt
gcccgcttgtcggccaagctggatcaagcattggacgcggtctatgcagatcctggcgtg
ccgatcaacgaccggctggaaaccgcctttgcgaaaatcgagctcgcgcgcctggcccag
ggacagccgaccgagaccgcgccgaaggaaccgcaaccaccgctaccggcggcggtcgtg
gagacggtgcatcagcgtgtgcagacgatagtggctgcagccaggaccgccgaggagcat
caatccatcaccgacagcgcagccgcgttgctgagcgaggtgggcgacagcagcggcgcc
gagcaattgctgctggccgaagtcggacgcagcaagaccccgtattactacatgccacgc
ctctcccagctcgccgaagaacgcggcgatcgcaagaccgcgttgtcctggctcaagaag
aactacaccactgccagcagccccgtcgcgcgcgcgcagtcgggcgcgcggtatgcagat
gggctgatccggctcagccccgaggacagtgccgccatcgaagcggtagccacccaggcg
atcggcgcgctggcagcacaatcggatgccgaccgccagcgcagccgtaagcgctttgcc
cggcttgggagcgcgctgaagacctggagcaagcagcatcagcaggaaggcactgcagtg
ctggcgcgattgcggcagaaaatgcaggccagctgcggcggcaagaacaccagcgagtgc
accagctggctgagttga

DBGET integrated database retrieval system