KEGG   Xanthomonas campestris pv. campestris B100: xccb100_4041Help
Entry
xccb100_4041      CDS       T00759                                 

Gene name
manB
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    xccb100_4041 (manB)
   00030 Pentose phosphate pathway
    xccb100_4041 (manB)
   00051 Fructose and mannose metabolism
    xccb100_4041 (manB)
   00052 Galactose metabolism
    xccb100_4041 (manB)
   00500 Starch and sucrose metabolism
    xccb100_4041 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    xccb100_4041 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    xccb100_4041 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    xccb100_4041 (manB)
Enzymes [BR:xca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     xccb100_4041 (manB)
    5.4.2.8  phosphomannomutase
     xccb100_4041 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4570816..4573158)
Genome map
AA seq 780 aa AA seqDB search
MSKANERRQGMSGVRTSGPVLGGMLLLLAGWFGWNSYAQWREDAIAQTLEQARDRAVQDV
RQAMTSQAGQLDAVLKQPQVVAALAGGDALAAASAIRERFKGAEDVQVLRGDLSAAYDNP
KDFGYARLSLLESALVGERAQVRVVRDAKQVRLGVAAAVALGGQPAVAYARLPLLRLTGP
LDAIAVPGQAYLALRQGSFNVVEQGDTALADAAETLARPLGDSGLRIAAAVPQSDSGPLG
LGALGCAIVAALLLVIAVLLVLASRGQVALPRRRVAGDAAADEPTFRQSLQQDASVAGEP
RALDAATPAPAALVPAVQVAAEMFRAYDIRGVVGKDLNPGIAALIGQAIGSVMQAQGLRD
IVVGRDGRLSGPELTNGLIEGLRRAGCNVTDIGLAPTPVVYFGAYELRAGSCVAVTGSHN
PPDYNGFKIVIGGETLSGAAITELHQRINEGRLHTAASPGELEQRDISDAYIQRIADDVQ
LDRPIKVVVDAGNGAAGEIAPRLLEAIGAEVVPLYCDIDGTFPNHHPDPSEPHNLGDLVQ
MVQRFDADIGVAFDGDADRLGVVTKEGAIVFPDRLLMLFAADVLQRNPGALVIYDVKCTG
KLSDYVLRNGGSPLMWKTGHSLIKAKMRETDAELAGEMSGHFFFKERWYGFDDGIYAAAR
LLEILAQREETPSDVLGELPESVSTPEIKVPVDGDAHALVARFVERAQAGEESPFEAARL
STIDGLRADFGDGWGLVRASNTTPILVLRFEADTAVALERIRALFRSELQALLPDHPLAF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgaacgagcgcaggcaggggatgtcgggcgtgcggacgagtggaccggtg
ttgggcggcatgctgctgctgttggccggctggtttggctggaacagttacgcgcaatgg
cgcgaggacgcgatcgcgcagacgcttgagcaggcgcgcgaccgcgccgtgcaggacgtg
cgtcaggccatgacctcgcaggccggccagctggacgccgtgctcaagcaacctcaggtg
gtggccgcgttggccggcggcgatgcacttgccgccgcctcggcgatccgcgagcgcttc
aagggcgccgaggatgtgcaggtgctgcgcggcgacctcagcgcggcgtacgacaacccc
aaagacttcggctatgcgcggctgagcttgctcgagtcggcgctggtcggcgaacgtgcc
caggtgcgcgtggtgcgcgacgccaagcaggtgcggctgggcgtggccgccgcggtcgcc
ctgggcggccagccggcggtggcctacgcacggctgccgttgcttcgcctgactggcccg
ctcgatgccattgccgtgcccgggcaggcctatctggcattgcgccagggcagcttcaac
gtggtggagcagggcgataccgcgctggcggacgccgccgaaaccctggcccgcccgttg
ggcgacagtggcctgcgcatcgctgcggcggtgccgcaaagcgacagcggcccgctgggg
ctgggcgcgctcggctgcgcgatcgtggcggcattgctgctggtgatcgcggtgctgttg
gtgctggccagccggggccaggtggccttgccgcgccgccgggtggccggtgatgcggcc
gcagacgagccgaccttccgtcagagcctgcagcaggacgccagcgtggccggcgagccc
cgcgcgctggacgctgccacgccggcgcctgcggcgctggtcccggctgtgcaggtcgcc
gcagaaatgttccgcgcgtacgacatccgcggcgtggtgggcaaggatctcaaccccggc
atcgccgcgctgatcggccaggccatcggcagcgtgatgcaggcgcaaggcctgcgcgac
atcgtggttggccgcgatggacgtttgtctggcccggaactgaccaacgggctgatcgaa
ggcctacgccgcgccggttgcaacgtcaccgacatcggcctggcgccgacgccggtggtg
tacttcggcgcctacgaattgcgcgccggcagctgcgtggcggtgaccggcagccacaat
ccgcccgactacaacggtttcaagatcgtgatcgggggcgagacgctctccggtgcggcg
atcaccgagctgcaccagcgcatcaacgaaggccgtctgcataccgcagccagccccggc
gaactggagcagcgcgacatcagcgatgcctacatccagcgcattgccgacgacgtgcag
ctggaccgcccgatcaaggtggtggtggacgccggcaatggcgcggccggcgagatcgcg
ccgcgtctgttggaggccatcggtgcggaagtggtgccgctgtattgcgatatcgacggc
acctttcccaatcaccatcccgacccgagcgagccgcacaatctcggcgatctggtgcag
atggtgcagcgcttcgatgcggatatcggcgtggccttcgatggcgatgccgaccgcttg
ggcgtggtcaccaaggaaggcgccatcgtcttccccgaccgcctgctgatgctgttcgcc
gccgatgtgctgcaacgcaatcccggcgcgctggtgatctacgacgtgaagtgcaccggc
aaactgtccgactacgtgttgcgcaacggcggcagcccgttgatgtggaagaccgggcat
tcgctgatcaaggcgaagatgcgcgaaaccgatgccgagctggccggtgaaatgagcggg
cacttcttcttcaaggagcgctggtacggcttcgacgatggcatctatgccgccgcgcgc
ctgctggaaatcctcgcccagcgcgaagagaccccgtccgacgtgctcggcgagctgccc
gaaagcgtgtccacgccggagatcaaggtaccggtggacggcgatgcgcatgcgctggtg
gcccggttcgtggagcgtgcccaggccggcgaggagtcgccgttcgaggccgcgcggttg
tccaccatcgatgggctgcgcgcggatttcggcgacggctggggcctggtacgtgcgtcc
aacaccaccccgatcctggtgctgcgcttcgaagccgacaccgctgtggcgctggaacgc
atccgcgcgctgttccgcagcgaactgcaggcgctgctgccggatcacccgctcgcattc
tga

DBGET integrated database retrieval system