KEGG   Xanthomonas campestris pv. campestris B100: xccb100_4113Help
Entry
xccb100_4113      CDS       T00759                                 

Definition
(RefSeq) arginase (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    xccb100_4113
  Amino acid metabolism
   00220 Arginine biosynthesis
    xccb100_4113
   00330 Arginine and proline metabolism
    xccb100_4113
Enzymes [BR:xca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     xccb100_4113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4646184..4647107)
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALIGRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMDASYAELRAGRMPVMLGGDHCLGIGSITAVAKYCREQLR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPQALTHLGGSAPAVLPEQIRQIGI
RSVDPDEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQGMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccctgattggcgtgcccaccgacatcggtgccggc
caccgtggtgcccggatggggccggaggcattgcgcatcgccgggctgcaggaggccttg
atcggacgcggcgtcgaggtgcgcgacctgggcaatctggatggcccgcgcaatccctgg
caggcaccgcaggccgggtaccggcatctggacgaggtggttgcctggaaccaggcgttg
atggacgccagctacgcagagctgcgcgcaggccgcatgccggtgatgctgggcggcgac
cattgcctgggcatcggttcgatcaccgcggtggccaagtattgccgcgagcagcttcgc
ccgctgcgggtgctgtggctggatgcgcattcggacttcaataccagcgaggtaaccccg
tccggtaacgtgcacggcatgccggtggcctgcctgtgcggccttggcccgcaggcgctg
acccacctgggcggcagcgcgcccgccgtgttgcccgagcagatccggcagatcggcatc
cgctcggtggacccggacgagaagcgcctgatcaagcagcaccgcatcgacgtctacgac
atgcgctacatcgacgaagccggcatgaagcgcaccatggaagcggccctgcaaggcatg
agcgccgatacccacctgcatgtgagcttcgatgtggacttcctggaccccagcattgcg
ccgggcgtaggcaccaccgtgccgggtgggccgaactaccgcgaggcccagctggtgatg
gagatgatcgccgacaccgggcgaatggggtcgctggatatcgtggagctcaatccggtg
ctagacaaccgcaacgccaccgccgagctggcggtggatctggtggaaagcctgttcggc
aagtcgacgctgatgcgagattga

DBGET integrated database retrieval system