KEGG   Xanthomonas campestris pv. campestris B100: xccb100_4145Help
Entry
xccb100_4145      CDS       T00759                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    xccb100_4145
Enzymes [BR:xca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     xccb100_4145
Exosome [BR:xca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   xccb100_4145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4675685..4676674)
Genome map
AA seq 329 aa AA seqDB search
MAHPHYRPRRMRHDAFSRRLMRENTLTTDDLIWPVFVHELPGRAPIASMPGVERLSLDEL
LREAENALELGIPVIDLFPVIDPAGKSLDAAEAWNPDGLAQRAVRALKARFPELGIMTDV
ALDPYTTHGQDGLIDAKGYVLNEITVEALVKQSLSHAQAGVDIISPSDMMDGRIGAIRRA
LDADDHLNVRIMAYSAKYASAFYGPFRDAVGSAGNLGKADKTTYQMDPANSDEAMREIAL
DLEEGADMVMVKPGMPYLDVVRRVKEEFRVPTFAYQVSGEYAMLKAASANGWLDERKCVL
EALMAFKRAGADGVLTYFAPQVARWLRED
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcccacccccactaccgtccccgccgcatgcgccacgatgcgttttcgcgccggttg
atgcgcgagaacacgttgaccaccgacgatctgatctggccggtgttcgtgcatgagttg
ccagggcgcgcgccgattgcctcgatgcccggcgtcgaacgtctgtcgcttgacgagttg
ctgcgcgaggcggaaaacgcgctggaactgggcatcccggtgatcgatctgttcccggtg
atcgaccccgccggcaagagcctggacgcggccgaagcctggaatccggacggcctggcg
cagcgcgcggtgcgtgcgctcaaggcgcgctttcccgagctgggcatcatgaccgacgtg
gcgctggatccgtacaccacccacggccaggacggtttgatcgacgccaagggttatgta
ctcaacgagatcaccgtcgaggcgttggtgaagcaatcgctgtcgcatgcgcaggcgggc
gtggacatcatttcgccctcggacatgatggacgggcgtatcggtgcgatccgccgcgcg
ctggatgccgacgaccatctcaacgtgcgcatcatggcgtattcggccaagtacgcctcc
gcgttctacggcccgttccgcgatgcggtgggcagcgccggcaatctcggcaaggccgac
aagaccacctatcagatggacccggccaacagcgacgaggccatgcgcgagatcgcgctg
gacctggaagagggcgcggacatggtgatggtgaagccaggcatgccgtatctggatgtg
gtgcggcgggtcaaggaagagttccgcgtgccgaccttcgcctaccaggtcagcggcgag
tacgcgatgttgaaggccgccagcgccaatggctggctggacgaacgcaagtgcgtgctg
gaagcgctgatggcgttcaagcgcgccggtgccgatggcgtgctgacctacttcgcgccg
caggtggcgcgctggctgcgcgaggactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system