KEGG   Xanthomonas campestris pv. campestris B100: xccb100_4243Help
Entry
xccb100_4243      CDS       T00759                                 

Gene name
phoD2
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xca00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:xca00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xca02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4797111..4798703
Genome map
AA seq 530 aa AA seqDB search
MSASDPARRRLLQGLGAGLLLPATAGWSTRTLAAPSGRPLITDGVQSGDVQGGRAILWSR
CDRPARLRVEWDTRPSLRHARRIDGPLALPTQDFTARVDLAALPPGQDIFYRVRFEDAHS
GVLSAPVHGHLRSTPQARDNVRFVWSGDTVGQGFGINPDIGGMRIYSAMRARNPDFFLHS
GDTIYADGPVPAELTVEDGKRWRNLTTAAKSKVAETLDEFRGNYRYNLLDENVRRFNAEV
AQVWQWDDHETTNNWSPGKQLDARYQVRDIEVLAARARKAFLEYALMRGVRADGDGRIYR
KISYGPLLDVFVLDMRSYRGANSDNLQPTPGADAAFLGPQQLAWLQRELAGSRAQWKVIA
ADMPIGLQVPDGQDADGRARWEAIANGDPGVPRGREQEIAALLRFISTARIRNTLWLTAD
VHYCAAHYYHPDQAAFQQFEPFWEFVAGPLNAGSFGPNALDATFGPTVVFQKAPPAPNTS
PLAGFQFFGEVEIDGHSGVLTVTLRDLDGVAQFRQPILPHGALPPHTANG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctccgatcccgcccgccgccgcttgctgcaaggtctgggtgccggcctgctg
ttgccggccacagccggttggtccacacgcacgctggcggcgccgtccgggcggccgctg
atcaccgatggcgtgcaaagcggcgatgtgcaggggggccgcgcgatcttgtggagccgc
tgcgatcgcccggcgcggttgcgggtggaatgggatacgcgaccgagcctgcgccatgca
cggcggatcgacggcccgctggcgctgcccacccaggatttcaccgcacgcgtggacctg
gccgcgctgccgccggggcaggacatcttctaccgggtgcgctttgaagatgcgcacagc
ggcgtgttgagcgcaccggtgcacgggcatctgcgcagcacgccacaggcacgcgacaac
gtgcgtttcgtatggagcggcgacaccgtgggccagggcttcggcatcaatccggacatc
ggtggcatgcgcatctattcggcgatgcgcgcacgcaacccggacttcttcctgcacagc
ggcgacaccatctatgccgatggcccggtcccggccgaactcacggtggaagacggcaag
cgctggcgcaatctcaccaccgcggccaagagcaaggtggccgagaccctggacgagttt
cgcggcaattaccgctacaacctgctcgatgaaaacgtccgtcgcttcaatgccgaggtg
gcgcaggtgtggcaatgggacgaccacgaaaccaccaacaactggtcgcccggcaagcag
ctggatgcgcgttaccaagtgcgcgatatcgaggtgctggcggcgcgcgcacgcaaggcc
ttcctggaatacgcgctgatgcgcggcgtgcgggccgacggcgatgggcgcatctaccgc
aagatcagctatggcccgctgctggatgtgttcgtgctggacatgcgcagttatcgcggt
gccaacagcgacaacctgcaaccaacgcccggcgcagatgccgcgtttctcggcccgcaa
caactggcctggctgcagcgcgaactggccggctcgcgcgcgcaatggaaagtgattgcc
gccgacatgccgatcgggttgcaggttcccgacggccaggatgcggatggacgtgcgcgc
tgggaagccattgccaatggcgatccgggcgtgccgcgcggccgcgagcaggaaatcgcc
gcattgctgcgtttcatcagcaccgcgcgcattcgcaatacgctttggctcaccgccgac
gtgcactactgcgcagcgcattactaccatccggatcaggccgcgtttcagcagttcgaa
ccgttctgggaatttgtcgccggcccgctcaatgccggcagtttcggcccgaatgcactg
gatgccaccttcggccccacggtggtgttccagaaggcgccaccggcaccgaacacctca
ccgttggcaggctttcagttcttcggcgaggtggagatcgacggccacagcggcgtgctc
acggtgaccttgcgcgacctcgatggtgtggcgcagtttcgccagccgatcctgccgcac
ggtgcattgccgcctcacaccgccaacgggtag

DBGET integrated database retrieval system