KEGG   Xanthomonas campestris pv. campestris B100: xccb100_4327Help
Entry
xccb100_4327      CDS       T00759                                 

Gene name
xynA2
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xca  Xanthomonas campestris pv. campestris B100
Brite
Enzymes [BR:xca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     xccb100_4327 (xynA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4898380..4899573)
Genome map
AA seq 397 aa AA seqDB search
MHLFRPLSFRCAMLLGLLGMAVSPIASAACTPGTTALKDAYAGGFLIGTAVNTDIVSGKD
AASAALVGCHFNAVTAENVMKAEVVAPQPGVFDFTAADAFVADGQRRGMFIVGHTLVWHN
QTPEWFFVDASGKPNTSQAQLERMRAHIARVAGRYVGKVQAWDVVNEIIDEDGSYRSTNW
VQRVGDGDTVVRNAFAFAQRYAPDAQLYYNDFNTWRPAKRDGIVRMVRMLQQAGIRIDGV
GMQGHWGLNYPSVQDIEAAIDAYAALGVKVMITELDIDVLPVTKGGQVIGTGFAHKQFQL
PEFKHFLDPYPDGLPPQVQTQLRDRYAELFALFWRKRDKLARVSVWGVTDGMSWKNDYPV
PGRTNYPLLFDRNHQPKPALDAVLAVPAGASGKQAEG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgtttcgcccactctcctttcgatgtgcaatgttgctgggcttgctcggcatg
gccgtctcgcccatcgcctcggcggcctgcacaccgggcaccacggcgctcaaggacgcg
tatgcaggcggctttctgatcggcaccgcggtcaatacggacatcgtctctggcaaggat
gcggcctccgcagcgctggttggctgccacttcaacgcggtgaccgccgagaacgtgatg
aaggccgaggtggtggcgccgcagccgggcgtgttcgatttcaccgcggccgatgccttt
gtcgccgacgggcagcggcgtggcatgttcatcgttggccatacgctggtctggcataac
cagacgccagagtggttctttgtcgatgcaagcggcaaaccgaatacgtcgcaggcccaa
ctcgaacgcatgcgcgcgcacatcgcacgcgtggctggccgctacgtgggcaaggtgcag
gcctgggacgtggtcaacgagatcatcgacgaggacggcagctaccgctccaccaactgg
gtgcagcgcgtcggcgatggcgacaccgtggtgcgcaatgcgttcgctttcgcgcagcgc
tatgcgcccgacgcacagctctactacaacgacttcaacacctggcggccggccaagcgc
gacggcatcgtgcgcatggtcaggatgctgcagcaggccggcatccgcatcgacggcgtg
ggcatgcaagggcattggggcctgaactaccccagcgtgcaggacatcgaagccgccatc
gacgcctacgctgcgctcggggtcaaggtcatgatcaccgagctggacatcgacgtgctg
ccggtcaccaagggaggccaggtgatcggcacgggttttgcgcacaagcagttccagttg
cccgaattcaagcactttctcgacccgtacccggatggcctgccaccacaggtgcagacg
cagctacgtgaccgctatgcggaattgttcgcgctgttctggcgcaagcgcgacaagctg
gcgcgcgtcagcgtttggggcgtcaccgatggcatgtcctggaagaacgattaccccgtg
cccggccgcaccaactacccgttgctgttcgaccgcaaccaccagcccaagccggccctg
gatgcagtgctggcggtgccggcaggcgctagcggaaagcaagcggagggctga

DBGET integrated database retrieval system