KEGG   Xanthomonas campestris pv. campestris B100: xccb100_4330Help
Entry
xccb100_4330      CDS       T00759                                 

Gene name
xynA3
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xca  Xanthomonas campestris pv. campestris B100
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4904126..4905118)
Genome map
AA seq 330 aa AA seqDB search
MSTHACALLLMLTAGLVPAAQAAPLAAGASKFLGSAYGPQQAPGFPQYWNKLTPENAGKW
GSVEAVRDQMDWSGLDTAYNFAKANGMPFQMHVLVWGNQQPEWIKHLPPAEQRREIEQWF
AAVAQRYPDIDLLEVVNEPLNDPPSKDDNGGGNYLQALGGNGASGWEWVLQSFRLARQQF
PRARLMINDYSITNSPQATQRYLQIVQLLQREQLVDAIGVQEHAFETTPNVAMSVHRANL
DTLASTGLPIYITEFDLDGPSDAQQVASYQRVFPVFWEHPAVAGITLWGYRPGLWRDKEA
AYLIRADGSERPALGWLRDYVAQHPGVRAP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgcatgcatgcgcactgttgttgatgctcaccgctggcctggtgccagccgcg
caggccgcgccgctggcggcgggcgcgtccaagttcctgggcagtgcctatggcccgcag
caggcgccagggtttccccagtactggaacaagctcacgccggaaaacgccggcaagtgg
ggcagtgtggaggcggtgcgcgaccagatggactggagcggcctggataccgcctacaac
ttcgccaaggccaacggcatgccgttccagatgcacgtgctggtgtggggcaaccagcag
ccggaatggatcaagcacctgccgccggccgagcagcgccgcgagatcgagcaatggttt
gccgcggtggcgcagcgctacccggatatcgacctgctggaagtggtcaacgagccgctg
aacgacccgcccagcaaggacgataacggcggcggcaattatctgcaggcgctcggcggc
aacggtgccagcggctgggagtgggtgctgcaatcgttccggctggcgcgccagcagttt
ccgcgtgcacggttgatgatcaacgactacagcatcaccaatagcccgcaggccacgcag
cgttatctgcagatcgtgcagctgttgcagcgcgagcagctagtggatgcgatcggcgtg
caggaacacgcgttcgaaaccacacccaacgtggcgatgtcggtgcaccgcgccaatctc
gacacgctggccagcaccggcctgccgatctacatcaccgaattcgatctggatggccca
agcgatgcgcagcaggtggccagctaccagcgtgtgtttccggtgttttgggagcacccg
gcggtggccggcatcacgctgtggggctatcgccccggcttgtggcgcgacaaggaagcg
gcttatctcatccgcgccgatggcagcgagcggccggcgctgggctggttgcgcgactac
gtggcccagcatcctggcgtgcgcgcgccgtga

DBGET integrated database retrieval system