KEGG   Xanthomonas campestris pv. campestris B100: xccb100_4418Help
Entry
xccb100_4418      CDS       T00759                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    xccb100_4418
Enzymes [BR:xca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     xccb100_4418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5009134..5011368)
Genome map
AA seq 744 aa AA seqDB search
MNHPNLLTALNQAGALRTLDLAFAQSLQRLAPDTDPQVLAGAALASLAVTSGHAGLDPTR
AAMLLDAREGPSHALPDPTDWQRTLAASRWVDQPNPQEPAAADCPLVLEHGLLYLRRYRE
YERRLALGLQRIAAHSPPPFAAATLAPLFEQLFPQASPLPQGEGARRAGEGTGLPEPSIY
QDGTNPPEPSHHQDHQAQAAALALRRTLLLVTGGPGTGKTTTIARLLLLRIAQAHASNTP
APRIALAAPTGRAAERMAESLRAAVARAIANGIDPALADALPTGASTLHRLLGVIPDSPQ
FRHTADNPLPFDLIVVDEASMVDLPLMCKLVEAVADGTQLILLGDADQLPSVEAGDVLAA
ILQAAGPGDTLQPQDADALQPLLGSAPPGSTPASIQTGGHTISHTHTGGLAGHRVHLLRG
YRQADNFALTPLADAIRTSDADTALALLRSGELAGVHFHEDGEDPLALGRDALLAHWRAL
ADAHDPAAALRDAARLRLLTAVRAGPQGARGLNARIEQLLAESGSGARRLGSASPWFQGR
LLLITENSYRHGLFNGDVGICLRSEASPFSERSDTNAPSERSDASTVTARSDAAASSGPS
HSIGTANRADPVAERRAQGPLVAWFEGDGDGQVRGFHPAALPAHESAFAMTVHKAQGSEF
DTVWLQLPTRDARVLSRELLYTGITRARRALHLAGSEAVIRSALARHAARISGLAWRLGA
QQQAAPAKPATEPSTALPVQGSLF
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacccaaacctcctaaccgccctcaaccaggccggcgccctacgcacgctagat
ctggccttcgcccagagcctgcaacgcctggccccggacaccgacccccaggtgttggcc
ggcgccgcactcgcctcactggccgtcaccagcggccacgcagggctggatcccacccgc
gccgccatgctgctggatgcgcgcgaggggccatcgcacgcgctcccggacccaaccgac
tggcaacgcaccctggccgcctcgcgctgggtcgaccaaccgaatccgcaagagccggcc
gccgccgactgcccgctagtcctcgaacacggcctgctctacctgcgccgctaccgcgag
tacgaacgccgcttggcactaggtctgcaacgcatcgccgcccattcgccgccgcccttc
gccgccgccacgctagccccgctgttcgagcagttattcccccaggcttcccctctcccc
cagggagagggtgcccgaagggcgggtgagggtacgggcctgcccgagccatccatctac
caagacggcacgaacccacccgagccatcccaccaccaagaccaccaagcccaagccgcc
gccctcgccctacgccgcaccctgctgctggtcaccggcggccccggcaccggcaagacc
accaccatcgcccgcctgctgttgctgcgcatcgcccaagcacacgcatccaacaccccg
gccccgcgcatcgccctggccgcacccaccggccgcgccgccgagcgcatggccgaaagc
ctgcgcgccgccgtcgcgcgcgccatcgccaacggcatcgacccggccctggccgacgcc
ctgcccaccggtgccagcaccctgcatcgcctgctcggcgtcatcccggactccccgcag
ttccgccacaccgccgacaacccgttgccattcgacctgatcgtcgtcgacgaggcttcc
atggtcgacctgccgctgatgtgcaagctggtcgaagccgtggccgacggcacccagctg
atcctgctcggcgacgccgaccagctaccctcggtggaagccggcgacgtgctcgccgcc
atcctgcaggccgccggccccggcgataccctgcagccgcaagacgccgacgcgctgcaa
ccgctgctcggcagcgccccccctggcagcacgcctgccagcatccagaccggcggccac
accatcagccacacccacaccggcggcctcgcaggccaccgcgtccacctgctacgcggc
taccgccaagcagacaactttgcactcaccccgttggccgacgccattcgcaccagcgac
gccgacaccgccctggccctgctacgcagcggcgaactggccggcgtgcacttccacgaa
gacggcgaggacccgctggccctgggccgcgacgcactgctcgcgcactggcgcgcgctg
gctgatgcacacgaccccgccgccgccctgcgcgatgccgcgcgcctgcgcctgctcacc
gccgtacgcgccggcccgcagggcgcccgcggcctcaacgcccgcatcgaacaactgctg
gccgaatccggctccggcgcccgtcgcctcggcagcgcctcgccctggttccagggccgc
ctgctgctgatcaccgaaaacagctaccgccacggcctgttcaacggcgacgtcggcatc
tgcctgcgcagcgaagcgagtcccttttcggagcgaagcgacacaaacgctccctcggag
cgcagcgacgcgagcaccgttacagcgcgtagcgacgcagctgcgtcttccggcccaagc
cacagcatcggcaccgcaaatcgcgccgaccccgtcgccgaacgccgtgcccaaggcccg
ttggtcgcctggttcgaaggcgacggcgacggccaggtgcgcggcttccaccccgccgca
ttgccggcgcacgaaagcgccttcgccatgaccgtgcacaaggcccagggcagcgaattc
gacaccgtctggctgcaactgcccacccgcgacgcccgcgtgctcagccgcgaactgctc
tacaccggcatcacccgcgcccgccgcgccctgcacctggccggcagcgaagcggtcatc
cgcagcgcactcgcccggcacgccgcacgcatctcaggtttggcgtggcggttgggtgcg
cagcagcaggcggcacccgccaagccagcaacagaaccatccactgcgttgcccgtgcag
gggtcgttgttctga

DBGET integrated database retrieval system