KEGG   Xanthomonas campestris pv. campestris 8004: XC_0026Help
Entry
XC_0026           CDS       T00247                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(30892..31941)
Genome map
AA seq 349 aa AA seqDB search
MSCSLWLRRLMSCAVFFLLLGVLPMGHAQTRALKYAGVNLAGAEFASSKKPGVLNKDYMY
PASTDYSYFAGTGMNVIRLPILWERLQPAARGELDPAQLALVQQAVARAKASGMYLVLDI
HNYSKYYGYKMGGPEVPLATFADLWRRLAVIFNSDNAVIFGLMNEPNNISASEWAGAAQA
GIDAIRATGANNLILVPGALWTGAHSWHSLTSDGYSNATALASISDPLNRYAFEVHQYLD
ADSSGTSSVCVSETIGADRLRAFTEWLRTNNKRGFLGEFGTANNAVCNTALQGMLAYMEN
YADVWLGWTWWAAGAWWNTSYAYNVHPNKDGTDKPQMVILSPQAARATR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgttctctgtggttgcgcaggctaatgtcctgcgcggtgttcttcctgctgctc
ggtgttctgccgatgggccatgcacaaacgcgtgcactcaagtacgccggcgtcaatttg
gcgggtgcggaatttgcgtcatcgaaaaaacctggcgtcctcaacaaggactacatgtat
cccgccagcaccgattacagctatttcgctgggactggaatgaacgtgattcgcctgccg
atcctgtgggaacgtctgcaacctgccgcacgcggcgagctggatccggcgcagctggca
ctggtgcagcaagcggtggcacgcgccaaggcatcgggcatgtatctggtgctggatatc
cacaactacagcaagtactacggttataaaatgggtgggccggaagtgccgctcgccacc
tttgccgatctgtggcggcgcctggcggtgatcttcaacagcgataacgccgtgatcttc
gggctgatgaatgagcccaacaacatctctgccagcgaatgggccggtgcagcgcaggca
ggcatcgatgcgatccgtgccaccggcgccaacaatctgatcctggtaccgggcgcgctg
tggaccggcgcacacagctggcactcgctgaccagcgatgggtattccaatgcaaccgcg
ttggcatcgatcagcgaccctctcaatcgctatgcgttcgaagtgcatcaatatctggat
gccgattccagcggcacctcaagtgtctgcgtcagtgaaaccatcggcgccgatcgcctg
cgtgcgttcaccgaatggctacgcaccaacaacaagcgtggttttctcggtgagttcggc
accgccaacaacgccgtctgcaataccgcgctgcaaggcatgctggcctacatggaaaac
tacgccgatgtctggctgggctggacatggtgggcagcgggcgcatggtggaacaccagc
tacgcctacaacgtgcatccgaacaaggacggcaccgacaagccgcagatggtcatcctc
tcgccgcaggccgcgcgcgctacacgctga

DBGET integrated database retrieval system