KEGG   Xanthomonas campestris pv. campestris 8004: XC_0027Help
Entry
XC_0027           CDS       T00247                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XC_0027
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XC_0027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(32350..33402)
Genome map
AA seq 350 aa AA seqDB search
MSASPSWPRQLLRCALVMLCIATMSIAQAQSPNRLKYAGVNISGAEIQSSKKPGVLNIDY
RYPTASEYRYFAGKQMNIVRLPILWERMQPKAQGPLDQAQLALLKQAVANAKAANQYLII
DVHNYAKYYGQKIGSKRVPVRTFTDLWRRLAIAFKSDNAVIFGLMNEPYDISPESWAAAA
QASIDSIRATGATNLILVPGALWSGAHSWYSTVAGQSNAVALANIRDPLNRYAIEVHQYL
DTDSSGTSAGCVSRTIGAERLRSFTGWLRAQGKRGFLGEFGTANNATCTAALDGMLGYLE
TNHDVWIGWTFWAAGAWWKTSYPFNVQPDAQGRDKPQMKTLSARAHRVTR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctccccctcctggccacgccagctgctgcgctgcgcgttggtcatgctgtgc
atcgccacgatgtccatcgcacaggcgcaaagccccaatcgtctgaaatacgcaggcgtc
aacatctccggtgcggagatccagtcgtccaaaaaaccgggcgtgctcaatatcgactac
cgctatccaaccgcgtccgagtacaggtacttcgcgggcaagcaaatgaacatcgtgcgc
ctgccgatcctgtgggagcgcatgcagcccaaagctcaaggtccgctggatcaggcacaa
ctggcattgctgaagcaggcagtggccaacgccaaggccgccaatcaatacctgattatc
gatgtgcacaactacgccaagtactacggccagaagattggcagtaagcgggtgccggtg
cgcacgttcaccgatctctggcgccgtctggccatcgcgttcaagagcgacaacgccgtg
attttcgggctgatgaacgagccgtacgacatctcgccagagagttgggccgccgccgcg
caggcgtccatcgacagcattcgtgccaccggtgccaccaacctgattctggtgcccggt
gcattgtggtcgggcgcacacagctggtattccaccgtggccgggcagtccaatgcagtg
gcgcttgcgaacatccgcgacccactgaatcgctatgcgatcgaagtccatcaatacctg
gataccgactccagcggcaccagtgccggttgtgtgagccgcacgatcggcgcggagcgc
ttgcgcagtttcaccggctggctgcgcgcgcaaggcaagcgcggttttcttggcgaattc
ggcaccgccaataacgcaacctgcactgcggcgctcgacggcatgctcggttatctcgaa
accaaccacgatgtgtggatcggttggacgttctgggccgcgggcgcgtggtggaaaacc
agctatccgttcaacgtgcagcccgatgcgcaaggccgcgacaagccgcagatgaaaacc
ctgagcgcacgcgcgcatcgcgtcacccgataa

DBGET integrated database retrieval system