KEGG   Xanthomonas campestris pv. campestris 8004: XC_0143Help
Entry
XC_0143           CDS       T00247                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XC_0143
Enzymes [BR:xcb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XC_0143
Exosome [BR:xcb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XC_0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
181515..183689
Genome map
AA seq 724 aa AA seqDB search
MTNRWDPGVTRALAEARHGDAFAVLGAHPSTNGRLLRTYHPGAEHVTAVLADGREVPLEA
GPEPGLFAGELPAEGRYRLRIGWPGGTQDTADPYAFGPLLSDFDLHLISEGHHLQLADAL
GANAVEVDGVRGTRFAVWAPNASRVAVVGDFNSWDARRHPMRLRHQAGVWELFVPDVGPG
AHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPHQWSDDGWMATRARRQAHD
APMSIYEIHAGSWLREEGLDLDWDGLADRLIPYVADMGFTHVELMPVTEHPFGGSWGYQP
LGLFAPTARFGSPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGTALYEHADP
REGFHRDWNTLIYNHGRREVSGFLIASALEFLQRYHVDGLRVDAVASMLYRDYSRNAGEW
VPNIHGGRENYETIAFLRRLNEVVREHAPGAVTIAEESTAWPGVTADVSHGGLGFHYKWN
MGWMHDTLHYIGLDPIYRRYHHGELTFSMVYAYSERFVLPISHDEVVHGKGSLLGRMPGD
DWQRFANLRAYLGFMFTHPGRKLLFMGCEFGQPTEWNHDAGLPWHLLDDARHRGVQTLVR
DLNHLYAQYPALHAHDDDPSGFAWLVGDDAANSVVAFLRKGKRGDAPVLVVINYTPVVQQ
GYRLGVPQGGLWREVFNSDAGIYGGANLGNGGAVTAEPQSMHGHAQSLPLLLPPLGVIVL
APQG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaatcgatgggaccccggcgtgacccgcgccctggccgaagcgcggcacggcgat
gcattcgccgtgctgggcgcacatcccagcaccaacggccgcctgctgcgcacctatcac
cccggcgccgagcacgtcaccgccgtgctggcggatgggcgcgaggtaccgctggaagcc
ggcccggaaccgggcctgtttgccggtgaattgccggcggaggggcgctaccgcctgcgg
atcggctggccgggcggcacccaggacaccgcagacccgtacgcgttcgggccgctgctc
agcgacttcgacctgcacctgatcagcgaaggccaccatctgcagctggccgatgcgctg
ggcgccaatgcggtggaagtggacggcgtgcgcggtacgcgctttgcggtgtgggcaccg
aacgcctcgcgcgtggcggtggtaggcgacttcaatagctgggacgcgcgccggcacccg
atgcggctgcgccaccaggccggcgtgtgggagctgttcgtgcccgacgtgggccccggc
gcgcactacaaatatcagctgcgtggtccgcatgggcatgaactgccggccaaggccgac
ccggtggcacgccgcgccgaactggcgccgggcactgcctcgatcgtggccgaccccacg
ccgcaccagtggagcgacgacggctggatggccacgcgtgcgcgccgccaggcgcacgac
gcaccgatgagcatctacgagatccatgccggctcctggctgcgcgaggaaggcctggat
ctggattgggatggcctggccgatcgcctgattccgtacgtggccgacatgggcttcacc
catgtggagctgatgccggtgaccgagcatccgttcggtggctcgtggggctaccagccg
ttgggcctgttcgcgcccaccgcgcgcttcggcagcccggatggctttgcgcgctttgtc
gaccgctgccaccgcgaaggcatcggcgtgatcgtggactgggtgccggcacactttccc
accgacgcgcacggcctggcccacttcgacggcaccgcgctgtatgaacacgccgacccg
cgcgagggcttccaccgcgactggaatacgctgatctacaaccatggccgccgcgaggtg
tctggctttctgatcgccagcgcgctggagttcctgcagcgctatcacgtcgatggcctg
cgcgtggatgcggtggcctcgatgctctaccgcgactacagccgcaatgccggtgagtgg
gtgcccaacatccatggcggccgcgaaaactacgaaaccatcgccttcctgcgccggctc
aacgaggtggtgcgcgagcacgcgccgggtgcggtgaccattgccgaagaatccaccgcc
tggccgggcgtgaccgcggatgtgtcgcatggcggcctgggcttccactacaagtggaac
atgggctggatgcacgacacgttgcattacatcgggctggacccgatctatcgccgctac
caccatggcgagctgactttcagcatggtgtacgcgtactcggagcgcttcgtgctgccg
atctcgcacgacgaagtggtgcacggcaagggctcgttgctgggccgcatgcccggtgac
gattggcagcgtttcgccaacctgcgcgcctatctcggtttcatgttcacccacccgggg
cgcaagttgctgttcatgggctgcgagttcggccagcccaccgagtggaaccacgacgcc
ggcttgccgtggcatctgctcgacgacgcacgccaccgcggcgtgcagacgctggtgcgc
gacctcaaccacctgtacgcgcaataccccgccttgcacgcgcacgacgacgacccatcg
ggcttcgcgtggctggtaggcgatgacgcggccaacagcgtggtggcgttcctgcgcaag
ggcaaacgcggcgatgcaccggtgctggtggtgatcaactacaccccggtggtgcagcag
gggtatcgcctcggggtgccgcagggcggcctgtggcgcgaagtgttcaacagcgatgcc
ggcatctacggcggtgccaacctgggtaacggcggtgcggtgactgccgagccgcagtcc
atgcatggccacgcgcagtcgctaccgttgctgctgccgccgctgggcgtcatcgtgctg
gccccgcagggctga

DBGET integrated database retrieval system