KEGG   Xanthomonas campestris pv. campestris 8004: XC_0171Help
Entry
XC_0171           CDS       T00247                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    XC_0171
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XC_0171
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     XC_0171
Lipid biosynthesis proteins [BR:xcb01004]
 Desaturase
  First
   XC_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
214057..215262
Genome map
AA seq 401 aa AA seqDB search
MLSDSIIDVLTSGIAGLGVWGMLAVLLVFTQLTIFAVTLYLHRSQAHRGVDFHPVIAHFF
RFWTWLTTSMITREWVAIHRKHHAKVETEEDPHSPQTKGIGQVFWRGVELYREARAQRAD
IEQYGKGAPNDWIERHLYTPHANAGPIALLVVNSVLFGLPGIALWAIQMAWIPFWAAGVV
NGLGHWWGYRNFESADTSTNLTPWALWIGGEELHNNHHAFPSSARFSMRRWELDIGWIAI
RCLQALGLAKVLRVAPSLDIRPNIAVPDADTLKALLSHRFQAMTDYQRNVLKPALREEAA
ATGAKLRQLLPRRLRKGLVDDGRWLKPDAREQLQHWVAQRPRMRTLVEYRARLTAVLEAR
SHDASERLKQLQQWCHEAEASGNAALQAYAARLKGYALSGT
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccgattcgatcatcgacgttctgacctccggcatcgccggcctgggcgtgtgg
gggatgctggccgtgctgctggtgttcacccaactcaccatcttcgcggtgaccttgtac
ctgcatcgcagccaggcgcaccgcggtgtggatttccatccggtcatcgcgcatttcttc
cgtttctggacctggctcaccacctcgatgatcacccgcgagtgggtggcgatccatcgc
aagcatcacgccaaggtggaaaccgaggaagacccgcacagcccgcagaccaagggcatc
ggccaggtgttctggcgcggcgtggagctgtaccgcgaagcacgcgcgcagcgggccgac
atcgagcagtacggcaagggcgcgcccaatgactggatcgagcggcatctgtacacgccg
cacgccaacgccggcccgatcgcgctgttggtggtcaacagcgtgctgttcgggctgccc
ggtatcgcactgtgggcgatccagatggcgtggattccgttctgggccgccggcgtggtc
aatggcctggggcattggtggggctatcgcaatttcgagtccgccgacacctccaccaac
ctgaccccgtgggcgctgtggatcggtggcgaagaactgcacaacaatcaccatgccttc
ccgagttcggcgcggttttcgatgcggcgctgggagctggacatcggctggatcgcgatc
cgctgcctgcaggcgctgggcctggccaaggtgctgcgggtggcgccgtcgctggacatt
cgccccaacatcgccgtgcccgatgccgacacgctcaaggcactgttgtcgcaccgcttc
caggccatgaccgactaccagcgcaacgtgctcaagccggccctgcgcgaagaggccgcc
gccaccggtgccaagctgcgccagctgctaccgcgccgcctgcgcaagggcctggtggac
gatggccgctggctcaagcccgatgcgcgcgaacagttgcaacactgggtggcgcaacgc
ccgcgcatgcgcacgctggtggaataccgcgcgcgcctcaccgccgtgctggaagcgcgc
agccacgatgcgtccgagcggctcaagcagctgcagcagtggtgccatgaagccgaagcc
agcggcaacgcggcattgcaggcgtatgcggcacggctcaagggttatgcgctgagtggc
acgtaa

DBGET integrated database retrieval system