KEGG   Xanthomonas campestris pv. campestris 8004: XC_0370Help
Entry
XC_0370           CDS       T00247                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:xcb00561]
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:xcb04626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(430240..431739)
Genome map
AA seq 499 aa AA seqDB search
MEKKYVLAIDQGTTSSRAMLFDRQGKVAGVAQREFGQIFPQPGWVEHNPREIMTSVYTTI
TELLNNAQIDAREISGIGITNQRETAVVWDKATGQPIYNAIVWQSRQTKDICTQLKEAGH
EQMVRDKTGLLIDAYFSGTKVKWILDHVDGARERARKGELAFGTIDSWLIWNLTGGKVHV
TDYTNASRTMMYNIHTLEWDAELLEMLDVPAQMLPEVRSSSEVYGMTQTQYFYGEQVPIA
GIAGDQQAALFGQACFEPGIAKNTYGTGCFMLMNTGDKAVASKAGLLTTIAWGIDGKVEY
ALEGAIFVAGSVVQWLRDGLRMFGKASDSQAYAERAGDNDGVYFVPAFVGLGAPYWRSDI
RGAVFGLTRGTSKEHFVRAAVESMAYQTRDVLTAMQSDSGIELKELRADGGAIANDFMAQ
FQSDILNVPVLRPEVAETTALGAAYLAGLATGFWSSREEIAKQWAVDRRFEPNMPEERRE
QLYAGWQQAVEATMGFRIS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaatacgtccttgcgatcgaccagggcaccaccagctcgcgcgcgatgttg
ttcgatcgccagggcaaggtggccggcgtggcgcagcgcgaattcggccagatctttccg
cagccgggctgggtggaacacaacccacgcgagatcatgaccagcgtctacaccaccatt
accgagctgctcaacaacgcgcagatcgacgcgcgcgagatctcaggcatcggcatcacc
aaccagcgcgagaccgcggtggtatgggacaaggccaccggccaaccgatctacaacgcc
atcgtctggcaatcgcggcagaccaaggacatctgcacccagctcaaagaggccggccat
gagcagatggtgcgcgacaagaccgggctgctgatcgatgcgtatttttccggcaccaag
gtcaagtggattctcgaccacgtggacggcgcacgtgaacgcgcacgcaagggcgagctc
gccttcggcaccatcgatagctggctgatctggaacctcaccggcggcaaggtgcacgtg
accgactacaccaatgcctcgcgcaccatgatgtacaacatccacaccctggagtgggat
gccgagctgctggagatgctggacgtgcccgcgcagatgctgccggaagtgcgctcgtcc
agcgaggtctatggcatgacccagacccagtatttctacggggaacaggtgcccattgcc
ggcattgccggcgaccagcaggccgcattgttcgggcaagcgtgctttgaaccgggcatc
gcgaagaacacctatggcaccggctgtttcatgctgatgaataccggcgacaaggccgtg
gcctccaaggccggcttgctgaccaccatcgcctggggcatcgacggcaaggtggaatac
gcactggaaggcgccatcttcgtggctggctcggtggtgcagtggctgcgcgatgggctg
cgcatgttcggcaaggcgagcgattcgcaagcctatgcggagcgtgccggcgacaacgac
ggcgtgtatttcgtcccggccttcgtgggcctgggcgcaccgtactggcgcagcgatatc
cgcggtgcggtgttcggcctgacccgcggcaccagcaaggaacacttcgtgcgcgcggcg
gtggaatcgatggcgtatcagacccgcgatgtgctcaccgcgatgcagagcgattcgggg
atcgaactgaaggagctgcgcgccgacggtggcgcgatcgccaacgacttcatggcgcaa
ttccagagcgacattctcaacgtgccggtgctgcgtccggaggtggccgaaaccaccgcg
ctgggcgcggcctacctggcgggcctggccaccgggttctggagcagccgcgaagagatc
gccaaacaatgggcggtggatcgccgcttcgagccgaacatgcccgaagagcggcgcgaa
cagttgtatgccggctggcagcaggcagtggaagccaccatgggcttccgcatcagctaa

DBGET integrated database retrieval system