KEGG   Xanthomonas campestris pv. campestris 8004: XC_0424Help
Entry
XC_0424           CDS       T00247                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XC_0424
Enzymes [BR:xcb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     XC_0424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
499745..501676
Genome map
AA seq 643 aa AA seqDB search
MSTQELHALAAAAGVMVDWVDASDQPRQVAPESIHAVLTALELPAANAAQRADSLQRIRA
TAAEPAPLVTVKVGEPLPLRVAPNAQGRWQAEDGSSEAARADAQGRLLAPARFGYWTLEL
GTTAQQVAVAPQRCFSVADACGQPAPRAWGMALQVYSARSADDGGIGDAAGAMEWVRQAA
GANADALALSPVHASRPITGGYSPYSPSDRRFLDPLHAAPVRVLGDAVHTAIAAVPGLRE
RLDGLHGTALIDWPASAAAKWELLRQLSTQVTPDHPELAAFRAQGGAALEAFAHFAARDF
GDGDAHLHVFTQWLAARSWADVQREAHERGMRIGLIADLAVGFDPNGAEAAAAADTVLRG
LVLGAPPDAFNADGQHWGIGAYSPTALRRSGFAPYIALLRAVLRDRGGIRIDHILGLLRL
WVVPDGASSGDGAYLAYPLQDLLNLLALESWRHRAIVIGEDLGVVPPGIREELSRRGVMG
IDVLMFTRDQEGAFVPPALWRADAVATTTTHDLPTLTGWRAGRDIDWRRKLELIQPAQAQ
ADHQTRTRDASRLDAAVADAGLGSDAPLLDALRFTASSVSPLALLPVEDALALDEQPNLP
GTVEVHPNWRRRLPDPLPQAQLTAALQGFAEARRVSAVSEPHP
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcaggaactgcatgccctggccgccgcggccggggtgatggtggattgggtg
gacgccagcgaccagccgcgccaggtggcgccggagtcgatccatgccgtgctcaccgcg
ctggaattgcccgctgccaacgccgcgcagcgcgccgacagcctgcagcgcatccgcgcc
actgccgccgagccggcgccgctggtgacggtgaaggtgggcgagcccttgccgttgcgg
gttgcgcccaacgcacagggccgctggcaggccgaagacggcagcagcgaggccgcgcgt
gccgatgcgcagggccggctgttggcgccggcgcgctttggctactggacgctggaactg
ggcaccacggcccagcaggtggccgtggcgccgcagcgctgcttcagcgtggccgacgcc
tgtggccagccggcgccgcgtgcgtggggcatggcgctgcaggtgtattcggcccgcagc
gccgacgatggcggcattggcgatgcggccggagccatggagtgggtgcggcaggccgcc
ggcgccaatgccgatgcgttggcgctgagcccggtgcatgcctcgcgcccgatcaccggc
ggctacagcccgtattcgcccagcgaccggcggttcctggaccccttgcacgccgcaccg
gtgcgcgtgctgggcgatgccgtgcacacggcgattgctgccgtgcccggcctgcgcgag
cgcctggacgggctgcatggcaccgcattgatcgactggccggcctcggccgctgccaag
tgggaactgctgcgccagctgtccacccaggtgacgccagaccacccggagctggcggcg
tttcgcgcccagggtggcgcggcgctggaggcatttgcgcacttcgccgcgcgcgacttc
ggcgatggcgatgcgcacctgcatgtgttcacccaatggctggccgcccgcagctgggcc
gacgtgcaacgtgaagcgcacgagcgcggcatgcggatcggcctgattgccgatctggcg
gtgggctttgatccgaatggtgccgaagccgccgccgcggccgacaccgtactgcgcggg
ctggtgctgggcgcgcccccggacgccttcaatgccgatggccagcactggggcatcggt
gcgtactcgcccaccgcgctgcgccgtagcggatttgcgccgtatatcgcgctgctgcgt
gcggtgctgcgcgaccgtggcggcatccgcatcgatcacatcctgggcctgctgcggctg
tgggtggtgcccgatggcgccagctccggcgatggcgcctacctggcgtatccgctgcag
gacctgctcaatctgctcgcgctggaatcctggcggcatcgcgccatcgtgatcggcgaa
gacctgggcgtggtgccgccgggcatccgcgaagagctctcgcgccgcggcgtgatgggc
atcgacgtgctgatgttcacccgcgaccaggagggtgccttcgtgccgccggcgctgtgg
cgtgcggacgcggtggccaccaccaccactcacgatctgcccaccctgaccggctggcgc
gccggccgcgacatcgactggcgccgcaagctcgagctgatccagccagcgcaggcgcag
gccgaccaccagacgcgcacgcgcgacgcttcgcgtctggacgcggccgtggccgacgcc
ggcctgggcagcgatgcgccgttgctggatgcgttgcgcttcaccgccagcagtgtgtcg
ccgctggccctgctgccggtggaagacgcgctggcgctggacgaacaacccaatctgccg
ggcaccgtcgaggtccatcccaattggcgccgacgcctgcccgaccccttgccccaggcg
cagctgaccgccgcgctgcagggttttgccgaggcgcgccgcgtctcggccgtttcggaa
ccgcatccatga

DBGET integrated database retrieval system