KEGG   Xanthomonas campestris pv. campestris 8004: XC_0639Help
Entry
XC_0639           CDS       T00247                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(766737..768191)
Genome map
AA seq 484 aa AA seqDB search
MSIFRTASTLALATALALAAGPAFSYSINNSRQIVDDSGKVVQLKGVNVFGFETGNHVMH
GLWARNWKDMIVQMQGLGFNAVRLPFCPATLRSDTMPASIDYSRNADLQGLTSLQILDKV
IAEFNARGMYVLLDHHTPDCAGISELWYTGSYTEAQWLADLRFVANRYKNVPYVLGLDLK
NEPHGAATWGTGNAATDWNKAAERGSAAVLAVAPKWLIAVEGITDNPVCSTNGGIFWGGN
LQPLACTPLNIPANRLLLAPHVYGPDVFVQSYFNDSNFPNNMPAIWERHFGQFAGTHALL
LGEFGGKYGEGDARDKTWQDALVKYLRSKGINQGFYWSWNPNSGDTGGILRDDWTSVRQD
KMTLLRTLWGTAGNTTPTPTPTPTPTPTPTPTPTPTPTPGTSTFSTKVIVDNSWNGGYCN
RVQVTNTGTASGTWSIAVPVTGTVNNAWNATWSQSGSTLRASGVDFNRTLAAGATAEFGF
CAAS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtccatattcaggaccgcaagcacgctcgctttggccaccgccctcgcactggccgcc
gggccggccttcagctattccatcaacaacagcaggcagatcgtcgacgacagcggcaag
gtcgtgcagctcaagggtgtgaacgtgttcggcttcgaaaccggcaaccacgtgatgcat
ggcctgtgggcacgcaactggaaggacatgatcgtgcagatgcagggcctgggcttcaac
gccgtgcgcctgccgttctgcccggccacgctgcgtagcgacaccatgccggccagcatc
gactacagccgcaacgccgacctgcagggcctgacctcgctgcagatcctcgacaaggtg
atcgccgaattcaatgcgcgcggcatgtatgtgctgctggatcaccacacccccgattgc
gccggcatttccgagctctggtacaccggctcctataccgaggcacagtggctggccgac
ctgcgctttgtggccaaccgctacaagaacgtgccgtatgtactcggcctggatctgaag
aacgaaccgcacggcgccgccacctggggtaccggcaacgccgccaccgattggaacaag
gctgccgagcgcggctcggccgcggtgttggcggtcgcgccgaagtggctgatcgcggtg
gaaggcatcaccgacaacccggtgtgctccaccaacggcggcatcttctggggcggcaac
ctgcagccgctggcctgcaccccgctcaacatcccggccaaccgcctgctgctggccccg
cacgtgtacggcccggacgtgttcgtgcagtcgtacttcaacgacagcaacttccccaac
aacatgcccgccatctgggaacgccatttcggtcagttcgccggcacgcatgcgctgttg
ctgggcgagttcggtggcaagtacggcgaaggcgacgcacgcgacaagacctggcaggac
gcgctggtgaagtacctgcgcagcaagggcatcaaccagggcttctactggtcgtggaat
cccaacagcggcgacaccggcggcatcctgcgcgatgactggaccagcgtgcgccaggac
aagatgaccctgctgcgcacgctgtggggcaccgccggcaataccacgccgacgccgact
cccacacctacgcccacaccgacaccgacgcctacccccacgccgacgcccaccccgggc
accagcaccttcagcaccaaggtgatcgtggacaacagctggaacggcggctattgcaac
cgcgtgcaggtgaccaacaccggcaccgccagcggcacctggtcgatcgcggtgccggtc
accggtacggtcaacaacgcctggaatgcgacctggtcgcagagcggcagcacgctcaga
gccagcggcgtggacttcaaccgcaccctggcagccggcgccaccgccgagttcggcttc
tgcgccgcgagctga

DBGET integrated database retrieval system