KEGG   Xanthomonas campestris pv. campestris 8004: XC_0872Help
Entry
XC_0872           CDS       T00247                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XC_0872
   01230 Biosynthesis of amino acids
    XC_0872
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XC_0872
   00030 Pentose phosphate pathway
    XC_0872
   00051 Fructose and mannose metabolism
    XC_0872
   00052 Galactose metabolism
    XC_0872
  Energy metabolism
   00680 Methane metabolism
    XC_0872
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XC_0872
Protein phosphatases and associated proteins [BR:xcb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     XC_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1050470..1051726)
Genome map
AA seq 418 aa AA seqDB search
MTNGNLLYAQSGGVTAVINATAAGVIGEARARKIKVLAARNGILGALREELIDTSKESAA
AIAALAQTPGGAFGSCRYKLKSLEQDRAKYERLLEVLRAHDVRWFLYNGGNDSADTALKV
SQLAKAFGYPLHCIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREAALDVAAMADTSTK
VFIYEAMGRHAGWLAAAAGLAGQGPDDAPQIILLPERAFDQPAFLAKVRQVVERVGWCVV
VASEGIQDAQGKFVADAGGATDSFGHAQLGGVASFLAAQVKQELGYKVHWTLPDYLQRSA
RHLASKTDWEQAQAVGKAAVQYALKGMNAVIPVIERVSDAPYRWKIVPAPLHKVANHEKK
MPPSFLRKDGFGLTERARRYFAPLIKGEAPLAYGSDGLPKYVTLKNVAVAKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacggcaacctgttgtatgcccagtccggcggtgtcactgccgtcatcaacgcc
accgctgccggggtgatcggcgaagcgcgcgcacgcaagatcaaggtgctggccgcacgc
aacggcatcctgggcgcactgcgcgaggaattgatcgacacctccaaggaatcggccgcg
gcgatcgccgcgctggcgcagacccccggcggcgcgttcggctcctgccgctacaagctc
aaatcgctggagcaggaccgcgccaaatacgagcgcctgctggaggtgctgcgcgcgcac
gacgtgcgctggttcctctacaacggcggcaacgactcggccgataccgcactgaaggtc
tcgcagctggccaaggcgttcggctacccgctgcactgcatcggcgtgcccaagaccatc
gacaacgacctggcggtgaccgacacctgccccggcttcggctcggccgccaagtacacc
gcggtctcggtgcgcgaagcggcgctggacgtggccgccatggccgacacctccaccaag
gtcttcatctacgaagcgatgggccgccacgccggctggctggccgccgccgcaggcctg
gccggccaaggcccggacgacgcgccgcagatcatcctgctgcccgagcgcgcctttgat
cagcccgcgttcctggccaaggtgcgccaggtggtggaacgggtcggctggtgcgtggtg
gtggccagcgagggcatccaggacgcacagggcaaattcgtcgccgatgccggtggcgcg
accgactcgttcggccacgcgcaactgggcggtgtggcctcgttcctcgcagcacaggtc
aaacaggaactcggctacaaggtgcactggacgctgcccgattacctacagcgttccgca
cgccacctcgcctccaagaccgactgggaacaagcccaggctgtgggcaaggccgccgtg
cagtacgcactcaagggcatgaacgcggtgatcccggtgatcgagcgcgtcagcgacgcc
ccctatcgctggaagatcgtgcccgccccgctgcacaaggtggccaaccacgaaaagaag
atgccacctagcttcctgcgcaaggacggcttcggcctcaccgaacgcgcccgccgctac
ttcgccccactgatcaagggcgaggccccgctggcctacggcagcgatggcctgccgaag
tatgtgacgttgaagaatgtggcggtggcgaagaaattgccggcttgggagggctga

DBGET integrated database retrieval system