KEGG   Xanthomonas campestris pv. campestris 8004: XC_1063Help
Entry
XC_1063           CDS       T00247                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00020  Citrate cycle (TCA cycle)
xcb00640  Propanoate metabolism
xcb00660  C5-Branched dibasic acid metabolism
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01130  Biosynthesis of antibiotics
xcb01200  Carbon metabolism
Module
xcb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xcb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XC_1063
   00640 Propanoate metabolism
    XC_1063
   00660 C5-Branched dibasic acid metabolism
    XC_1063
Enzymes [BR:xcb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     XC_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: AAY48133
UniProt: Q4UXU0
Position
1280665..1281834
Genome map
AA seq 389 aa AA seqDB search
MNFHEYQSKQLLAEYGIPVPAGKVASTPDEAVEVANSLGKGPWMVKAQIHAGGRGKAGGV
KFCKTTDDVKAAADKMLGTKMSTYQTAGVELPVNLVLVTTAGEIVKELYLSILVDRGTKT
ITYIASSEGGVEIEQVAAETPELIHSLNVDFVEGVQGYHGRDFGFKLGLNAKQAGQFASI
MVNLYRLFNDKDLALVEINPLAILDDGNLYALDGKFDSDDNAAFRQKALVAMRDKTQEDE
TEVTASELDINYVTMDGNIGCMVNGAGLAMATMDVIKLNGGEPANFLDVGGGANKQRVIE
AFKLILSSDKVEGIFVNIFGGIVRCDMIAEGIIAAVKEVGVKVPVVVRLEGTNVEEGKQL
LRDSGMAIIPADNINDGAKKVVEAVKNAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccacgaataccagtcaaaacagctgcttgccgagtacggcatccccgtcccg
gccggtaaggtcgcgtccacgccggacgaagcggttgaagtcgccaactccttgggcaag
ggcccctggatggtcaaggcgcagatccacgcgggcggccgcggcaaggctggcggcgtc
aagttctgcaagaccaccgacgacgtgaaggccgcagcagacaagatgctcggcaccaag
atgtccacctaccagaccgcaggcgtcgagttgccggtcaacctggtgctggtgaccacc
gccggcgagatcgtcaaggagctgtacctgtcgatcctggtcgaccgcggcaccaagacc
atcacctatatcgcctcgagcgaaggtggcgtggagatcgaacaggtcgccgccgagacg
ccggagctgatccactcgctcaacgtcgatttcgtcgaaggcgtgcagggctaccacggc
cgcgatttcggcttcaagctcggcctcaatgccaagcaggccggccagttcgccagcatc
atggtgaacctgtatcgcctgttcaacgacaaggacctggcgctggttgaaatcaacccg
ctggcgatcctggacgacggcaacctgtacgcgctggacggcaagttcgacagcgacgac
aacgccgcattccgtcagaaggcgctggtcgccatgcgcgacaagacccaggaagacgag
accgaagtgactgcttcggagctggacatcaactacgtcaccatggacggcaacatcggt
tgcatggtcaacggcgctggcctggccatggccaccatggacgtcatcaagctcaacggc
ggcgagccggcgaacttcctggacgtgggcggcggtgccaacaagcagcgcgtcatcgag
gcgttcaagctgatcctgtcctcggacaaggtcgaaggcattttcgtcaacatcttcggc
ggcatcgtccgctgcgacatgatcgccgaaggcatcattgccgcggtcaaggaagtgggc
gtcaaggtgccggtcgtggtgcgcctggaaggcaccaacgtggaagaaggcaagcaactg
ctgcgtgacagcggcatggccatcatcccggccgacaacatcaacgacggcgccaagaag
gtcgttgaagctgtcaagaacgctgcctga

DBGET integrated database retrieval system