KEGG   Xanthomonas campestris pv. campestris 8004: XC_1133Help
Entry
XC_1133           CDS       T00247                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xcb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1375274..1375858
Genome map
AA seq 194 aa AA seqDB search
MIGRLRGILAYKQPPWLVIDVGGVGYELEAPMSTFYDLPDVGRDVILFTHYAQKEDSVSL
YGFLREGERRLFRDVQKVTGIGAKIALAVLSGVTVDEFARLITSGDITALTRIPGIGKKT
AERMVVELRDRAADFSSGAPITGQLGPDAVSEATVALQQLGYKPAEAARMAREAGAEGDE
VATVIRKALQAALR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccgtctgcgcgggatcctggcctacaagcagccgccgtggctggtgatcgac
gtgggcggggtgggctatgagctggaggcgccgatgagcaccttctacgacctgcccgat
gtcggccgcgacgtcatcctgttcacccattacgcgcagaaggaagacagcgtgtcgctg
tacggcttcctgcgcgagggcgagcgccggctgttccgcgacgtgcagaaggtcaccggc
atcggtgccaagattgcgctggcggtgctgtccggggtcaccgtggacgaattcgcgcgg
ctgatcaccagtggcgacatcactgcgctgacccgcatccccggcatcggcaaaaagacc
gccgagcgcatggtggtggagctgcgcgaccgcgcggccgacttcagcagcggcgcgccg
atcaccggccagctgggcccggatgcggtgtccgaggccaccgtggcgttgcagcagctg
ggctacaagcccgccgaggccgcgcgcatggcacgcgaggccggggccgaaggcgacgag
gtcgccaccgttattcgcaaggccctccaggccgcgctgcgctag

DBGET integrated database retrieval system