KEGG   Xanthomonas campestris pv. campestris 8004: XC_1214Help
Entry
XC_1214           CDS       T00247                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XC_1214
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XC_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1476358..1478199)
Genome map
AA seq 613 aa AA seqDB search
MLRTTLAPLVLALSIALPITATAASDDQWPTFATQGTQFVRDGKPYQVLSGAIHFQRIPR
TYWKDRLQKARALGLNTVETYVFWNLVEPQQGQFDFNANNDVAAFVREAAAQGLNVILRP
GPYACAEWEAGGYPAWLFGKDNIRIRSRDPRFLAASQSYLDAVAQQVRPLLNHNGGPIIA
VQVENEYGSYDDDHAYIADNRAMFVKAGFDKALLFTSDGADMLANGTLPGTLAVVNFAPG
EAKSAFDKLIKFQPDQPRMVGEYWAGWFDHWGTPHASTNAKQQTEELEWILRQGHSANLY
MFIGGTSFGFMNGANFQGNPSDHYAPQTTSYDYDAILDEAGRPTPKFALMRDVITRVTGV
QPPALPAPIAMAALKDAPLRESASLWDNLPAPIAIDTPQPMEHFGQDYGYILYRTTVTGP
RKESLYLGEVRDVARVYVDQKPVGSVERRLQQVATEVDIPAGQHTLDVLVENSGRINYGP
RMADGRAGLVDPVLLDNQQLTNWQAFPLPMRSPDSIRGWTRNTVEGPAFHRGNLRIGTPA
DTYLDMRAFGKGIAWANGVNLGRHWNIGPQRALYFPAPFQRKGDNTVVVFDLDSTAKPSV
RGLQQQVWITPKE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtaccacgcttgccccgcttgtcctggccctgtccatcgcactgcccatcacc
gccacggccgccagcgatgaccagtggcccaccttcgccacccagggcacgcagttcgtg
cgcgacggcaagccgtaccaagtgctttccggtgccatccatttccagcgcattccgcgt
acctactggaaagaccgcctgcaaaaagcgcgtgcgctgggcttgaacacggtggaaacc
tacgtgttctggaacctggtcgaaccgcagcaggggcaattcgatttcaacgccaataac
gacgtggccgcgttcgtgcgcgaggccgccgcgcaaggtctcaacgtgatcctgcggccg
ggcccgtacgcctgtgcggaatgggaagccggtgggtatccggcctggctcttcggcaag
gacaacatccgcatacgcagccgcgacccgcgctttctcgccgccagccagtcctacctg
gatgcagtggcgcagcaggtgcgcccactgctcaaccacaacggcggcccgatcatcgcc
gtgcaggtagagaacgaatacggctcctacgacgacgaccatgcctacatcgccgacaac
cgcgccatgttcgtcaaggccggcttcgacaaggcgctgctgtttacctccgacggcgca
gacatgctcgccaacggcaccctgccgggcacgttggccgtggtcaatttcgccccgggc
gaggccaagagtgcgttcgacaaactgatcaagtttcagccagaccaaccgcgcatggtc
ggcgaatactgggccggctggttcgaccattggggcacgccgcacgccagcaccaacgcc
aagcagcaaaccgaagaactggaatggatcctgcgccagggccattccgccaacctctac
atgttcatcggcggcaccagtttcggcttcatgaatggtgccaattttcagggcaatccc
agcgaccattacgcaccgcagaccaccagctacgactacgacgccatcctggacgaagcc
ggccgccccacgcccaagttcgcgctgatgcgcgatgtcatcacgcgcgtcaccggcgtg
cagccgccggccttgccggcaccgatcgccatggccgcgctgaaagacgcaccgctgcgc
gagtcggcctcgctgtgggacaacctgcccgcgcccatcgccatcgacacgccgcagccg
atggaacatttcggccaggactatggctacatcctgtatcgcaccaccgtcaccggcccg
cgcaaggagtcgctgtatctgggcgaggtacgcgacgtagcacgcgtctatgtggatcag
aagcctgttggtagcgtcgaacgccggctgcaacaggtcgccaccgaggtggacattccg
gctggccaacacaccctggatgttctggtcgaaaacagcggccgcatcaactacggcccg
cgcatggccgacggccgcgccggcctggtcgacccggtactgctggacaaccagcaactc
accaactggcaggccttcccgctccccatgcgctcgccggacagcatccgcggctggacg
cgtaacacagtggaaggccccgcctttcatcgcggcaacctgcgcatcggcacgcccgcc
gacacctacctggacatgcgcgcattcggcaaaggcatcgcctgggccaacggcgtcaac
ctcggcaggcactggaacatcggcccgcaacgtgcgctgtacttcccggcaccgttccag
cgcaagggcgacaacaccgtggtggtgttcgatctggacagcaccgccaagcccagcgtg
cgtggtttgcagcagcaggtgtggatcacgccgaaggagtaa

DBGET integrated database retrieval system