KEGG   Xanthomonas campestris pv. campestris 8004: XC_1227Help
Entry
XC_1227           CDS       T00247                                 

Definition
sulfite synthesis pathway protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    XC_1227
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     XC_1227
Transfer RNA biogenesis [BR:xcb03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    XC_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1501371..1502171
Genome map
AA seq 266 aa AA seqDB search
MIRIPMELRETVIAIARQAGDAIMEVYAQDFAVEIKADASPLTQADLAANRVIVEGLRRV
TPDVPVLSEESVHVAWEERQYWTSYWLVDPLDGTREFVKRNGEFSVNIALIHMGAPVLGV
VQAPVDGRVWYAARGENAYRRDGDRDEMLHSRTPAAAPLRVAASRSHRDARTAAALERMG
QIDVVAQGSSLKFCRIAEGELDVYPRFGPTSEWDTAAGQCVLHAAGGALLAAGTGKPFRY
NRRDTLLNGDFIALGDPGLPWRDWLV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcatcccgatggaattgcgcgagaccgtgatcgcgatcgcgcgccaggccggc
gacgccatcatggaggtgtacgcgcaggatttcgctgtcgagatcaaggccgacgccagc
ccgttgacccaggccgacctggccgccaaccgcgtcatcgtggaaggcttgcgccgggtc
acgccggatgtgccggtgttgtcggaagagtctgtccacgtggcctgggaagaacgccag
tactggaccagctattggctggtcgacccgctggatggcacgcgcgagttcgtcaagcgc
aacggcgagttcagcgtcaacatcgccctgatccacatgggcgcgccggtgctcggcgta
gtgcaggcgccggtcgatggacgggtctggtatgcggcgcgcggtgagaacgcctaccgc
cgcgatggcgaccgcgacgaaatgctgcattcgcgcacgcccgctgctgccccgctgcgg
gtcgccgccagccgctcgcatcgcgatgcacgcacagccgcagcgctggaacgcatgggc
cagatcgacgtggtggcgcagggttcctcattgaagttctgccgcatcgccgaaggcgag
ctggatgtgtacccgcgcttcggtcccacctccgagtgggacaccgccgctggccagtgc
gtgctgcatgccgccggtggcgcgttgctcgcggccggcaccggcaagccgttccgctac
aaccgccgcgacaccttgctcaatggcgacttcatcgccctgggcgaccccggcctgccg
tggcgcgactggctggtgtaa

DBGET integrated database retrieval system