KEGG   Xanthomonas campestris pv. campestris 8004: XC_1318Help
Entry
XC_1318           CDS       T00247                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xcb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:xcb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1605922..1607196
Genome map
AA seq 424 aa AA seqDB search
MAKIVVTGGQALHGEVHISGAKNAVLPILCATLLADAPVEISNVPHLHDVITTVKLLSEL
GAEVTIDEGTLAKGRSILVDPRSVTHQIAPYELVKTMRASILVLGPLLARYGTAEVSLPG
GCAIGSRPVDQHIKGLQALGADISVENGYIKATSNGRLKGGRYVFDMVSVTGTENVLMAA
VLAEGTTVLENAAMEPEVTDLADCLIALGAQIEGAGTPRITVQGVERLGGGHHAVLPDRI
ETGTFLVAAAMTGGSVTVRRARPDTLDAVLDKLTEAGATITTTADSVTLDMHGKRPRAVN
LTTAPYPAFPTDMQAQFMALNCVADGVGVINETIFENRFMHVNELLRLGADIQVEGHTAI
VRGAERLSGAPVMATDLRASASLILAGLVADGDTTIDRIYHLDRGYENIEEKLGALGATI
RRIA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatcgtagtgaccggcggccaagcgctgcacggtgaggtccatatttccggc
gccaagaacgcggtgctgccgatcctgtgcgcgaccctgctggccgatgcgccggtggag
atcagcaacgtgccgcacctgcacgatgtgatcaccacggtgaagctgctcagcgagctg
ggcgccgaggtcaccatcgatgaaggcacgctggccaaggggcgctcgatcctggtcgac
ccgcgttcggtcacccaccagatcgcgccgtacgagctggtcaagaccatgcgcgcctcg
atcctggtgctgggcccgctgctggcgcgctatggcacggccgaagtgtcgctgcccggc
ggttgcgcaatcggctcgcggccggtggaccagcacatcaagggcctgcaggcgctgggt
gccgacatcagcgtggaaaacggctacatcaaggccaccagcaacgggcggctcaagggc
gggcgttacgtgttcgacatggtcagcgtcaccggcaccgagaacgtgctgatggccgcc
gtgctggccgaaggcaccaccgtgctggaaaacgcggcaatggagccggaagtcaccgac
ctggccgactgcctgatcgcgctgggcgcacagatcgaaggcgcgggcacgccgcgcatc
acggtgcagggcgtcgagcgcctgggcggcggccaccatgcggtgctgccggaccgcatc
gagaccggtacctttttggtggccgcagcgatgaccggcggcagcgtcaccgtgcgtcgc
gcgcgcccggacaccctggacgcggtgctggacaagctcaccgaggccggcgcgacgatc
accaccactgccgacagcgtcaccctggacatgcacggcaagcgcccgcgcgcggtcaac
ctgaccactgcgccgtacccggcgtttcccaccgacatgcaggcgcaattcatggcgctt
aactgcgtggccgacggcgtgggcgtgatcaacgagacgatcttcgaaaaccgcttcatg
cacgtcaacgagctgctgcgcctgggtgcggatatccaggtggaagggcataccgcgatc
gtgcgcggcgccgaacgcctcagcggcgcgccggtgatggccaccgacctgcgtgcgtca
gcctcgctgatcctggccggcctggtcgccgacggcgacaccaccatcgatcgcatctac
cacctggaccgtggctacgaaaacatcgaggagaagctgggggcgctgggcgcgaccatc
cggcgcatcgcatga

DBGET integrated database retrieval system