KEGG   Xanthomonas campestris pv. campestris 8004: XC_1404Help
Entry
XC_1404           CDS       T00247                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XC_1404 (gpmA)
   01230 Biosynthesis of amino acids
    XC_1404 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XC_1404 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    XC_1404 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XC_1404 (gpmA)
Enzymes [BR:xcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XC_1404 (gpmA)
Exosome [BR:xcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XC_1404 (gpmA)
  Exosomal proteins of melanoma cells
   XC_1404 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1692995..1693744
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVDLTEQGRQEAAAAGKLMKDEGLQFDVAYTSVLK
RAIHTLQGALKELDQDWLPVHKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDI
PPPAMDVTDPGHPGHDRRYATLDRNALPGTESLATTLVRVLPYWHDAIAPQLKAGQTVLV
TAHGNSLRALYKYLNDISNAQILELNIPTGIPLLFELDDNLQVQSYRYLGDPEAAKRAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcaaactcgtactgctgcgccatggccagagccaatggaacctggacaaccgt
ttcaccggctgggtggacgtggatctcaccgagcagggccgccaggaagccgccgcggcc
ggcaagctgatgaaggacgaagggctgcagttcgatgtggcgtacacctcggtgctcaag
cgcgccatccacacgctgcagggcgcgctgaaggagctcgaccaggactggctgccggtg
cacaagagctggcgcctcaatgagcgtcactacggtggcctgcagggcctggacaaggcc
gaaaccgcggccaagcacggcgaagagcaggtcaagatctggcgccgttcctacgacatc
ccgccgccggccatggacgtcaccgatccgggccatcccgggcatgaccgccgctatgcc
acgctggaccgcaatgcattgccgggcaccgagtcgctggcgaccacgctggtgcgcgtg
ttgccgtactggcacgacgcgatcgccccgcagttgaaggccggccagaccgtgctggtc
accgcgcacggcaactcgttgcgcgcgctgtacaagtacctcaacgacatctccaacgcg
cagatcctggagctcaacattcccaccggcatcccgctgttgttcgagctggacgacaac
ctgcaggtgcaaagctaccgctacctgggcgacccggaagcggccaagcgcgccgccgaa
gccgtggccaaccagggcaaggccaagtaa

DBGET integrated database retrieval system