KEGG   Xanthomonas campestris pv. campestris 8004: XC_1575Help
Entry
XC_1575           CDS       T00247                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XC_1575
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XC_1575
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XC_1575
Enzymes [BR:xcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XC_1575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1893926..1895143
Genome map
AA seq 405 aa AA seqDB search
MSAQPISDFHAYPDAAGHFGKFGGRFVAETLIAPLQELSAAYDLARQDPAFIAEYDKDLK
HYVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMQLLGAKVIPVTSGSATLKDA
LNEAMRDWVSNVQDTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMLEDYGRLPDAISA
CVGGGSNAIGLFHAFLNDPGVKIYGAEAAGDGIASGRHAASIAAGRPGVLHGNRTYVICD
DDGQIIETHSVSAGLDYPGVGPEHAFLSDSGRAVYQGITDDEALAAFHLLAHTEGILAAL
ESSHAVAQSIKLAREMPKDALVLCNLSGRGDKDVHTIAAREGMVL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccagcccatcagtgactttcatgcgtacccggatgccgccggccatttcggc
aagtttggcgggcgcttcgtcgcggaaaccttgatcgcgcccctgcaggaactgtctgcc
gcctacgatctggcgcgccaggatccggccttcattgccgagtacgacaaggatctcaaa
cattacgtcggccgccccagcccgatctaccacgccgagcggctgagccgcgaagtgggc
ggggcgcagatcctgctcaagcgcgaagacctgaaccacaccggcgcgcacaagatcaac
aacaccatcggccaggcgctgctggccagccgcatgggcaagacccgcatcattgccgag
accggcgccggccagcatggcgtggccagtgccaccgtcgcggcgcggctgggcctggaa
tgcgtggtctacatgggcgcgaccgacatcgaacggcagaagatcaacgtctaccgcatg
cagttgctcggtgcgaaggtcatcccagtcacctcgggctcggccacgctcaaggacgcg
ctgaatgaagcgatgcgcgactgggtcagcaacgtgcaggacaccttctacatcatcggc
accgtcgccggcccggatccgtatccgcgcatggtgcgcgatttcaacgccatcgtcggc
cgcgaagcgcgtgcgcagatgctggaagactacggccgcctgccggatgcgatcagcgcc
tgcgtgggcggcggcagcaacgccatcggtttgttccatgcgttcttgaacgaccccggc
gtcaagatctacggcgccgaagcggcgggtgatggcattgccagcggccgccatgcggca
tcgatcgccgccgggcgccccggcgtgctgcacggcaatcgcacgtatgtgatctgcgat
gacgacggccagatcatcgagacccattcggtctcggcgggcctggactacccaggcgtg
gggccggagcatgccttcctctccgacagcggccgtgccgtgtaccagggcatcaccgac
gacgaagcgctggccgcgttccacttgctggcgcataccgaaggcatcctggccgcgctg
gaatccagccatgcggtcgcgcagtcgatcaagcttgcgcgcgaaatgcccaaggacgcg
ctggtgctgtgcaacctgtccggccgtggcgacaaggacgtgcacaccatcgccgcacgc
gaaggcatggtgctgtga

DBGET integrated database retrieval system