KEGG   Xanthomonas campestris pv. campestris 8004: XC_1577Help
Entry
XC_1577           CDS       T00247                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xcb01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:xcb00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:xcb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1895655..1896473
Genome map
AA seq 272 aa AA seqDB search
MSRAPDRIAACFDALRHSGRKALIPFITAGDPSLEATVPVMHALVRAGANIIELGVPFSD
PMADGPTIQRSSERALGRGAGLAYVIEAVQEFRREDATTPVVLMGYLNPIEIHGTRRFAE
TAVAAGIDGVLLVDLPPEEADETRAIFTEVGLALIALASPTTGEARLDMLCSTAQGYLYY
VSFSGVTGAADRLDTHAASDRLRQLRARAGAPVVAGFGIKDAASAAAMAVDADGVVVGSA
LVAALADASDVRSARKRAEDFLQPLRQALDAG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgcgcccgaccgtatcgctgcgtgcttcgacgcgctgcgtcactccggccgc
aaggcgctgattcccttcatcaccgccggcgacccctcattggaagccaccgtgccggtg
atgcatgccctggtgcgcgctggtgcgaacatcatcgagctcggcgtgccgttctccgac
ccgatggccgacggccccaccatccagcgcagctccgagcgcgcgctgggccgcggtgcc
gggctggcctatgtgatcgaagccgtgcaggaattccggcgcgaggacgccaccaccccg
gtggtactgatgggctacctcaacccgatcgaaatccacggcacgcggcgctttgccgaa
accgcggtggccgccggcatcgatggcgtgctgctggtcgacctgccgcccgaggaggcc
gacgagacccgcgccatcttcaccgaggtcggtctggcgctgatcgccttggcgtcgccc
accaccggcgaggcccggctggacatgctgtgcagcactgcgcagggctatttgtattac
gtcagcttctctggcgtgactggcgcggccgaccggctggacacgcacgcggccagcgac
cgcctgcgccagctgcgcgcccgtgccggcgcacccgtggtggccggcttcggcatcaag
gacgccgccagtgctgccgcgatggcggtggatgcggacggcgtggtcgtcggcagcgcg
ctggtggcggccctggccgatgcgtcggatgtgcgcagcgcgcgtaagcgggccgaagac
ttcctgcagccgctgcggcaggcgctggacgccggctga

DBGET integrated database retrieval system