KEGG   Xanthomonas campestris pv. campestris 8004: XC_1587Help
Entry
XC_1587           CDS       T00247                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XC_1587
   01230 Biosynthesis of amino acids
    XC_1587
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XC_1587
   00051 Fructose and mannose metabolism
    XC_1587
   00562 Inositol phosphate metabolism
    XC_1587
Enzymes [BR:xcb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XC_1587
Exosome [BR:xcb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XC_1587
  Exosomal proteins of bladder cancer cells
   XC_1587
  Exosomal proteins of melanoma cells
   XC_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1906980..1907735
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGTRAFATELVAQVAAHMPLAGVDVVILPPLPYLGDLIEDFEAHHLAF
GAQDVSSNEKGAYTGEVSASMLVDVGAEYGLVGHSERRQYHQESSELVARKFAAAMHAGL
IPVLCVGESLEQREAGQTEAILRAQLEPVLSLVGSAGFARAVVAYEPIWAIGTGRTATPD
QAQAVHAFIRGEVAKADARIADSLPILYGGSVKPDNASELFSQPDVDGGLVGGASLVAED
FLAIARAAAAC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaaagatcgttgctggaaattggaagctgcatggcacgcgtgccttcgccacc
gaactggtggcgcaggtggccgcgcacatgcccctggcgggtgtcgatgtcgtcatcctg
ccgcccttgccgtatctcggtgatctgatcgaggacttcgaggcccaccacctggcattc
ggtgcacaggacgtcagtagcaacgagaagggcgcctacaccggtgaagtgtccgcctcg
atgctggtggatgtcggtgccgaatacggcctggtcgggcattcggagcgccgtcagtat
caccaggaaagtagcgagctggtcgcgcgcaagtttgccgccgcaatgcatgccgggttg
atcccggtgctgtgcgttggcgaatcgctggaacagcgcgaggcaggtcagactgaggca
atcctacgtgcccagttggagccggtcctgagcctggtcggcagtgccggattcgcccgc
gccgtggtggcctacgagccgatctgggccatcgggaccgggcgcaccgccacgccggac
caggcccaggccgtgcacgccttcattcgtggcgaagtcgcgaaggcggatgctagaatt
gccgattcactgcccatcctgtacggggggagtgtcaagcccgacaacgccagcgagctg
ttttcccagcccgacgtcgacggtgggctggtcggcggcgcatcactggttgccgaagac
ttcctggccattgcgcgtgcggcggccgcttgttaa

DBGET integrated database retrieval system