KEGG   Xanthomonas campestris pv. campestris 8004: XC_1648Help
Entry
XC_1648           CDS       T00247                                 

Definition
cyclomaltodextrin glucanotransferase
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
Enzymes [BR:xcb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.19  cyclomaltodextrin glucanotransferase
     XC_1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1981903..1983681
Genome map
AA seq 592 aa AA seqDB search
MAGRATDLRAGDRRLEPDRGRCVRGAGPKRPGRAMMRSVLMAAMLLYSGAACAAPAPGDY
YGTLEPFAADAVYFVVTDRFVNGDTGNDHRDQGGAHRSFDVPTPCDGGVGDNIGYLGGDF
KGIVDHADYIRGLGFGAVWITPIVDNPDEAFTGGKPITCESTLSDHGKTGYHGYWGVNFY
RLDEHLPSPGLDFAGFTRSMHANDLKVVLDIVGNHGSPAYSMPVAQPGFGKLYDAQGRLV
ADHQNLAPAQLDPAHNPLHAFYNTSGGLAELSDLNEDNPAVLDYLAGAYLQWMEQGADAF
RIDTIGWMPDRFWHAFVARIREKRPGVFMFGEAFDYDPAKIAGHTWARNAGVSVLDFPLK
QQLSAVFGHKQAGFEQLATPLYLRKGPYGNPYELMSFYDNHDMARLDASDTGFIDAHNWL
FTARGIPVIYYGSETGFMRGRAEHAGNRNYFGEERVSNAPQSPIFGPLQRIATLRRNTPA
LQRGVQVDLQLRGDQAAFLRVYQHAGMTQTALVLLNKGDAAADIAVSRLLQPGSWRDAFS
GEQVQVQGRVTLQVPAHGVRVLLSDAPVTDVALRKQLDAQMADQAARDARNK
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtggctgggcgggcaaccgatctacgcgctggcgatcggcggcttgagcctgatcgtggc
cggtgtgtgcgtggtgcgggtcccaagcgcccagggagggcaatgatgcgcagcgtcttg
atggcagccatgctgctttattcgggagcagcctgcgctgcgcctgcacccggtgattac
tacggcaccctggaaccgttcgccgccgatgcggtgtatttcgtggtcaccgatcgcttc
gtcaacggcgacacgggcaacgatcaccgcgaccagggcggcgcacatcgcagcttcgat
gtgcccacaccgtgcgacggtggcgtgggcgacaacatcggttacctcggcggcgacttc
aagggcatcgtcgatcatgccgactacattcgcggcctcggctttggcgcggtgtggatc
accccgatcgtcgacaacccggacgaagcgttcaccggtggcaagcccatcacctgcgag
agcacgctcagcgatcacggcaagaccggttatcacggctattggggcgtcaatttttac
aggctcgacgaacatctccccagcccggggctggatttcgccgggttcacgcgctccatg
cacgccaatgacctgaaggtggtgctggatatcgtcggcaaccacggctcgcccgcctac
agcatgccggtggcgcagcccgggtttggcaagctctacgacgcacagggccgcctggtt
gccgatcatcagaacctcgcacccgcacagctcgacccggcgcacaacccgttgcacgcg
ttctacaacaccagcggcggcctggcggaattgtcggacctcaatgaagacaacccggct
gtgctggactatctagccggcgcctacctgcagtggatggagcagggtgccgatgcgttt
cgcatcgacaccatcggctggatgccagaccgcttctggcatgccttcgtagcgcggatc
cgcgagaaacgcccgggcgttttcatgtttggcgaagccttcgactacgacccggccaag
atcgccggccacacctgggcgcgcaacgccggcgtcagcgtgctggacttcccgctcaaa
cagcagctatccgccgtgttcggccacaaacaggctggcttcgaacagctcgccacgccg
ctgtatctgcgcaaaggcccgtatggcaacccgtacgagttgatgagcttctacgacaac
cacgacatggcgcgcctggatgccagcgataccggcttcatcgatgcgcacaattggttg
ttcaccgcgcgcggcattccggtgatctattacggctcggaaaccggcttcatgcgcggg
cgcgccgaacacgcgggtaatcgcaattattttggcgaagagcgcgtcagcaacgcaccg
cagagcccgatcttcggcccgctgcagcgcatcgcgaccttgcggcgcaataccccggcc
ctgcagcgcggcgtgcaggtggatctgcagttgcgcggcgaccaggcagcgttcctgcgc
gtctaccagcatgcgggcatgacgcagaccgcgttggtcttgctcaacaagggcgacgcg
gcggcggacattgcggtgtcccgcttgctgcagcccggcagctggcgcgacgccttcagt
ggcgagcaggtgcaggtgcaaggtcgcgtgacgctgcaggtgccggcgcatggcgtgcgc
gtgctgctgtcggatgcgccggtgaccgacgtcgccctacgcaagcagctggacgcacag
atggcggaccaggccgcgcgcgatgcacgcaacaagtag

DBGET integrated database retrieval system