KEGG   Xanthomonas campestris pv. campestris 8004: XC_1727Help
Entry
XC_1727           CDS       T00247                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XC_1727
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XC_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2086529..2088289
Genome map
AA seq 586 aa AA seqDB search
MTIFQTLLTAMVIASPIAACAADTTGTAGTTPAAGATIHVNQLGYLPGSAKLAVVGLPAS
AAAGPDRFTVEDAKGARVLEGSLSPAASWAPAGQQARVADFSALRTPGTYRLKIAGMPAS
DAFPIAASAYQPVVDASLKAFYYNRASTELPAQFAGRYARAAGHPDTEVRIHPSAASATR
PANSVISAPKGWYDAGDYNKYIVNSGISTYTVLAAYEHYPALFKAQALTIPNDAPGVPGI
LQEVWWNLEWMLAMQDPADGGVYHKLTDKQFDGLVMPDQAKQQRYVVMKATAATLDFAAV
MAAASRVYAPFDKQYPGASARMLKAARSAWAWAQQHPNVIYRQPDDVRTGGYDDATVDDE
FAWAAAELYVSTREDAFYDAMLARNVHASVPGWSNVGGLAWMSLAAHRDQLTPHADRARI
EGEISGLAQRLGDQWQASPWRLAMADNDFVWGSNAVVLNQAMMLLQGYRVTQQRRYLDAA
QSQLDYILGRNPLGLSFVTGVGQRTPMHIHHRPSEADGIDAPVPGWLAGGPQPGQQDAKD
CKVAYPSKLAALSYLDNTCSYATNEVAINWNAPLVYVSAAIEASTR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaccattttccagaccctgctcaccgccatggtgatcgcatcgcccatcgccgcctgt
gcggcggacacgaccggcactgccggcaccacgccggccgctggcgccaccatccacgtc
aatcaactcggctatctgccgggctcggccaagctggcggtggtcggcttgccggcgtcc
gctgcggccggtccagaccgcttcacggtggaggatgccaagggcgctcgcgtgctggag
ggcagcttgtcgccggcggccagttgggcaccggcggggcaacaggcacgcgtggccgac
ttttccgcactgcgcacgccgggcacgtatcggttgaagatcgccggcatgccggcctcg
gatgcattcccgattgcagcgagtgcctaccagccggtcgtggatgcctcgctgaaggcg
ttctactacaaccgtgccagtaccgagttgccggcgcagtttgccgggcgctacgcgcgc
gcggccgggcatccggacaccgaggtgcgcatccatccgtcggcggcgtctgccacgcgc
ccggccaacagcgtgatcagcgcgcccaaggggtggtacgacgcgggcgactacaacaag
tacatcgtcaattccggcatcagcacctacaccgtgctggccgcgtatgagcactacccg
gcgctgttcaaggcgcaggcactcaccattcccaacgatgcgcctggcgtgcccggcatc
ctgcaggaagtgtggtggaatctggaatggatgctggccatgcaggacccggccgatggc
ggggtgtaccacaagctcaccgacaagcagttcgatgggctggtgatgccggaccaggcc
aagcagcagcgctatgtcgtgatgaaggccaccgccgccacgctggatttcgccgcggtg
atggcggcggccagccgcgtgtatgcgccgttcgacaagcagtatccaggcgcgtcggcg
cgcatgttgaaggcggcgcgtagtgcctgggcgtgggcgcaacaacacccgaacgtgatc
tatcgccagcctgacgacgtgcgtaccggcggctacgacgacgccaccgtagatgacgaa
tttgcctgggcagcagcggagctctatgtgagcacgcgcgaggacgcgttctacgacgcc
atgctggcgcgcaacgtacatgccagcgtgccggggtggagcaacgtgggtggattggcc
tggatgtcgttggccgcccaccgtgaccagctcacgccgcatgccgaccgcgcacgtatc
gaaggcgaaatcagcgggctggcgcagcgcctgggcgaccagtggcaggcatcgccgtgg
cgtttggccatggccgataatgactttgtctggggcagcaatgcggtggtactcaatcag
gccatgatgctgctgcagggctaccgggtgacgcagcaacgtcgttatctggatgcggcg
caatcgcagctggactacatcctggggcgcaatccgctggggctgtcgttcgtcaccggg
gtcgggcagcgcacgccaatgcatatccaccatcgcccatccgaagccgacggcatcgat
gcgcccgtgccgggctggctggccggtggcccgcagccgggccagcaggacgcgaaagac
tgcaaggtggcgtatccgtccaagctggccgcgctgtcgtatctggacaacacctgcagc
tacgcgacaaacgaggtagcgatcaactggaatgcgccgctggtgtatgtaagtgctgcg
atcgaggcgtcgacccgctga

DBGET integrated database retrieval system