KEGG   Xanthomonas campestris pv. campestris 8004: XC_1879Help
Entry
XC_1879           CDS       T00247                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00330  Arginine and proline metabolism
xcb00332  Carbapenem biosynthesis
xcb01100  Metabolic pathways
xcb01130  Biosynthesis of antibiotics
xcb01230  Biosynthesis of amino acids
Module
xcb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XC_1879
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    XC_1879
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     XC_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AAY48942
UniProt: Q4UVI1
Position
2272313..2273401
Genome map
AA seq 362 aa AA seqDB search
MLKVGSSLLAADGGGLSPRFALGLAQFVSANLAAGREVVIVSSGAVAAGRAILPKAAEAG
AAIAARQALAALGQAQLIALWQRFFERPVAQVLLTHDDLRNRRRYLNARATLGELLRLGA
LPVINENDTVSVDELKLGDNDNLAAIVAALVDADALFIATDIDGLYSADPRSNPLARPLD
EVAELSAEVLAMAGGSGSSVGTGGMRTKLEAAAKAGAAGIETYLFNGRSAEVVRGLAQDR
LCGTRIHAARTRIAARKYWLRHAPVEPGTILIDAGAALALTDKGASLLPGGVAGAEGDFR
RGDMVEIHLRDSVGSRCLARGVSQYSALDVRRIARRHSREIEPILGYSYGENVVHRDDLV
VL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaaggtcggcagcagcctgctggcggccgatggcggcggcctgtcgccgcggttt
gcgctgggcctggcgcagtttgtatcggccaatctggcggcggggcgcgaagtggtgatc
gtctcgtccggcgcggtggcggccgggcgcgccatcctgcccaaggcagccgaagctggc
gccgccatcgctgcgcgccaggcactggccgcgctgggccaggcgcagttgatcgcgttg
tggcagcgctttttcgagcgcccggtggcgcaggtgctgctcacccacgacgacctgcgc
aaccgccgccgctacctcaatgcgcgcgccacgctgggcgaactgttgcggctgggcgca
ttgccggtgatcaacgagaacgacaccgtgtcggtggatgaactcaagctcggcgacaac
gacaacctggccgcgatcgtggccgcgctggtcgatgccgatgccttgttcatcgccacc
gatatcgatggcctgtacagcgccgacccgcgcagcaacccgctggcacgcccgctcgac
gaggtggccgaactcagcgccgaggtgctggcgatggccggcggcagcggcagcagcgtg
ggcaccggcggcatgcgcaccaagctggaagccgccgccaaggccggtgcggccgggatc
gaaacctatctgttcaacggccgcagtgccgaggtggtgcgcgggctggcgcaggaccgg
ctgtgcggcacgcgcatccacgccgcgcgcacgcgcattgccgcgcgcaaatactggctg
cggcatgcgccggtggagccgggcacgatcctgatcgacgccggcgccgcgctggcgctc
accgacaagggcgcctcgctgctacccggtggcgtggccggtgccgaaggcgatttccgc
cgtggcgacatggtggaaatccacctgcgcgacagcgtgggcagccgctgcctggcacgt
ggcgtgagccagtattcggcacttgatgtgcgccgcatcgcccgccgccattcgcgcgag
atcgaaccgatcctcggctacagctacggcgagaatgtggtgcatcgtgatgatctggta
gttttgtag

DBGET integrated database retrieval system