KEGG   Xanthomonas campestris pv. campestris 8004: XC_1879Help
Entry
XC_1879           CDS       T00247                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XC_1879
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XC_1879
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    XC_1879
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     XC_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2272247..2273401
Genome map
AA seq 384 aa AA seqDB search
MTQPVVATSLFTEQVLPPWRRAVLKVGSSLLAADGGGLSPRFALGLAQFVSANLAAGREV
VIVSSGAVAAGRAILPKAAEAGAAIAARQALAALGQAQLIALWQRFFERPVAQVLLTHDD
LRNRRRYLNARATLGELLRLGALPVINENDTVSVDELKLGDNDNLAAIVAALVDADALFI
ATDIDGLYSADPRSNPLARPLDEVAELSAEVLAMAGGSGSSVGTGGMRTKLEAAAKAGAA
GIETYLFNGRSAEVVRGLAQDRLCGTRIHAARTRIAARKYWLRHAPVEPGTILIDAGAAL
ALTDKGASLLPGGVAGAEGDFRRGDMVEIHLRDSVGSRCLARGVSQYSALDVRRIARRHS
REIEPILGYSYGENVVHRDDLVVL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacccagccggtcgtcgcgacctcgctgtttaccgagcaggtgctgccgccgtggcgg
cgcgcagtgctcaaggtcggcagcagcctgctggcggccgatggcggcggcctgtcgccg
cggtttgcgctgggcctggcgcagtttgtatcggccaatctggcggcggggcgcgaagtg
gtgatcgtctcgtccggcgcggtggcggccgggcgcgccatcctgcccaaggcagccgaa
gctggcgccgccatcgctgcgcgccaggcactggccgcgctgggccaggcgcagttgatc
gcgttgtggcagcgctttttcgagcgcccggtggcgcaggtgctgctcacccacgacgac
ctgcgcaaccgccgccgctacctcaatgcgcgcgccacgctgggcgaactgttgcggctg
ggcgcattgccggtgatcaacgagaacgacaccgtgtcggtggatgaactcaagctcggc
gacaacgacaacctggccgcgatcgtggccgcgctggtcgatgccgatgccttgttcatc
gccaccgatatcgatggcctgtacagcgccgacccgcgcagcaacccgctggcacgcccg
ctcgacgaggtggccgaactcagcgccgaggtgctggcgatggccggcggcagcggcagc
agcgtgggcaccggcggcatgcgcaccaagctggaagccgccgccaaggccggtgcggcc
gggatcgaaacctatctgttcaacggccgcagtgccgaggtggtgcgcgggctggcgcag
gaccggctgtgcggcacgcgcatccacgccgcgcgcacgcgcattgccgcgcgcaaatac
tggctgcggcatgcgccggtggagccgggcacgatcctgatcgacgccggcgccgcgctg
gcgctcaccgacaagggcgcctcgctgctacccggtggcgtggccggtgccgaaggcgat
ttccgccgtggcgacatggtggaaatccacctgcgcgacagcgtgggcagccgctgcctg
gcacgtggcgtgagccagtattcggcacttgatgtgcgccgcatcgcccgccgccattcg
cgcgagatcgaaccgatcctcggctacagctacggcgagaatgtggtgcatcgtgatgat
ctggtagttttgtag

DBGET integrated database retrieval system