KEGG   Xanthomonas campestris pv. campestris 8004: XC_1930Help
Entry
XC_1930           CDS       T00247                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XC_1930
   00052 Galactose metabolism
    XC_1930
   00500 Starch and sucrose metabolism
    XC_1930
   00520 Amino sugar and nucleotide sugar metabolism
    XC_1930
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XC_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2329624..2330517
Genome map
AA seq 297 aa AA seqDB search
MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR
YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVMCAK
AVVGDEPFAVLLPDDLMWNRGDAALTQMADVAEASGGSVIAVEDVPHDKTASYGIVSTDA
FDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFEYLESTGAGAGGEIQLTDAIAEL
LKQEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGAPAKEIIRSALAAADARG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgtattcgcaaggccgtattccccgtcgcaggtcttgggacccgctttctt
ccggcaaccaagacggtgccgaaggaaatgctgccgatcatcgataaaccgcttatccag
tacgccgtggacgaagccatccaggccggttgcgatacgctgatcttcgtcaccaatcgc
tacaagcactcgatcgccgactacttcgacaaggcctatgagctggagcagaagctcgag
cgcgcaggcaagctcgagcaattggagctggtgcgccatgcactgcccgaaggcgtccgc
gccatttttgtgacgcaggccgaagcgctcggcctgggccatgcggtgatgtgtgccaag
gccgtggtcggtgacgaaccgttcgcagtgctgctgcccgacgacctgatgtggaaccgc
ggcgatgcggcgctgacccagatggccgatgtggcagaagcctccggcggcagcgtgatc
gccgtggaagatgtgccgcacgacaagacggccagttatggcatcgtgtccaccgatgcg
ttcgacggccgcaagggccgcatcaatgccatcgtcgaaaagcccaagccggaagtggcg
ccgagcaatctggcggtcgtcggtcgttacgtgctgagcccgaagatcttcgagtacctg
gagtccacgggcgccggtgcaggtggcgagatccagctcaccgatgcgatcgccgaactg
ctcaagcaggaacaggtcgatgcgttccgtttcgagggccgtcgcttcgactgcggcgcg
cacatcggtttgatcgaggccacggtgcactttgcgctcgagcacgagaagcatggcgca
ccggcgaaggaaatcattcgcagcgccttggccgcggccgacgcacgcggctga

DBGET integrated database retrieval system