KEGG   Xanthomonas campestris pv. campestris 8004: XC_1956Help
Entry
XC_1956           CDS       T00247                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:xcb00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:xcb00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2360344..2361102)
Genome map
AA seq 252 aa AA seqDB search
MRSILITGAGSGIGAGLATVLAADGHHLLVSDADLAAAEQTTQQVRAAGGSAEALVLDVT
DEHSIAQALAAAARAPEVLVNNAGLQHVAPLEEFPMQRWALLVDVMLTGAARLSRAVLPG
MRAGGYGRIVNIGSIHSLVASPYKSAYVAAKHGLIGLSKVLALETADCDITANTLCPSYV
RTPLVERQIADQARTRGIAEDAVIREVMLKPMPKGAFIEYDELAGTVAFLMSHAARNLTG
QAIAIDGGWTAQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcatcctgatcaccggtgccggcagcggcatcggcgccggcctggccaccgtt
cttgccgccgacggccaccacctgctggtgagcgacgccgacctggccgcggccgagcag
accacccagcaggtgcgtgcggccggcggatcggccgaggccctggtactggacgtcacc
gacgagcacagcattgcccaggcactggcggccgccgcgcgcgcgcccgaggtgttggtc
aacaacgccggcctgcagcacgttgcgccgctggaggagttcccgatgcagcgctgggcg
ctgctggtggacgtgatgctgaccggtgccgcacgtctcagccgcgcggtgctgccgggc
atgcgtgcgggcggctacgggcgcatcgtcaacatcggcagcatccattcgctggtggcc
agcccttacaagagcgcctacgtggctgccaagcatgggctgatcgggctgtccaaggtg
ctcgcgctggaaaccgccgactgcgacatcaccgccaacacgctgtgccccagctatgtg
cgcacgccgctggtggagcggcagatcgccgaccaggcacgcacgcgcggcattgccgaa
gacgcggtgatccgcgaggtgatgctcaagccgatgcccaaaggcgccttcatcgagtac
gacgaactggccggcaccgtggccttcctgatgtcgcacgcggcgcgtaatctcaccggc
caggccatcgccatcgacggtggctggaccgcgcaatga

DBGET integrated database retrieval system