KEGG   Xanthomonas campestris pv. campestris 8004: XC_1976Help
Entry
XC_1976           CDS       T00247                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XC_1976 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XC_1976 (glk)
   00052 Galactose metabolism
    XC_1976 (glk)
   00500 Starch and sucrose metabolism
    XC_1976 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XC_1976 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XC_1976 (glk)
   00524 Butirosin and neomycin biosynthesis
    XC_1976 (glk)
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XC_1976 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2388690..2389697)
Genome map
AA seq 335 aa AA seqDB search
MTAPSKPVLVADIGGTNARFALADIDASVPLLDDTCREFAVVEFGSLGEAARYYLDQIGV
QATKGVFAVAGRVDGDEARITNHPWVISRSRTATMLGFSTLHLINDFAAQAMAISLLRPQ
DVVQVGGASWRPAPIELPRNYGVIGPGTGLGVGGLIIRNGRCFPLETEGGHVSFPPGTPE
EIRVLEILSEQFGRVSNERLICGPGLVNIHRALSEIAGIDPGPLEPKDITARAAAGDPRA
SRTIDLFCAIFGAIAGDMVLMQGAWDGVFLTGGLVPKVLDSLQHSGFRQRFEHKGRFSAI
MSRVPSLAVMHPHAGLLGAAAYAVDAERALPGEQR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgctccttccaagccggtgctggttgccgacatcggtggcaccaacgcgcgcttc
gcgctggccgacatcgatgcctcggtaccgctgctggacgacacctgccgtgagttcgcg
gtggtcgagttcggctcgctgggcgaggccgcgcgctattacctggaccagattggcgtg
caggccaccaagggcgtgttcgcggtggccggccgtgtggatggcgacgaagcccgcatc
accaaccatccgtgggtgatctcgcgctcgcgcaccgccaccatgctgggcttcagcacg
ctgcacctgatcaacgacttcgccgcgcaagcgatggcgatcagcctgctgcgcccgcag
gacgtggtgcaggtgggcggcgccagctggcgcccggcaccgatcgagctgccgcgcaac
tacggcgtcatcggcccgggcaccgggctgggcgtgggtggcctgatcatccgcaacggc
cgctgttttccgctggaaaccgaaggcggccatgtcagcttcccgcccggcacgccggaa
gagattcgcgtgctggagatcctgtccgagcagttcggccgggtctccaacgagcgcctg
atctgcggcccgggcctggtcaacatccaccgcgcgctgagcgagattgccggcatcgac
cccggcccgctggagcccaaggacatcaccgcacgtgccgccgctggcgacccgcgtgcc
tcgcgcaccattgatctgttctgcgccatcttcggcgcgatcgccggtgacatggtgctg
atgcagggtgcctgggacggcgtcttcctcaccggcgggctggtgcccaaggtgctggat
tcgctgcagcattccggcttccgccagcgcttcgaacacaagggccgtttctccgcaatc
atgtcgcgggtgccctcgctggcggtgatgcatccgcatgccggcctcctgggtgcagcg
gcgtatgcggtggacgccgaacgcgcattgccgggagagcagcgatga

DBGET integrated database retrieval system