KEGG   Xanthomonas campestris pv. campestris 8004: XC_2163Help
Entry
XC_2163           CDS       T00247                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:xcb02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:xcb02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2608388..2609440)
Genome map
AA seq 350 aa AA seqDB search
MTIENNRNIVAIGGSAGASQALRTLLADLPRDLPAAVLVVLHLSPQGTGIVEMVRSAVRG
LPVYVASDGVPLVPGAVYVAVPDSHLMVDGMHVVLGRGPRENMSRPSIDALFRSVAVSHG
ARALGVLLSGMLNDGCAGLEAIQACGGAVAVQDPDDAIADDMPRNALRALTPDVVAPSAA
LGAVITDLVREPAAWPIAPSDALKLEVAIARGQPSTTEVMTQLGEPVALSCPACGGVLTK
LHTPGTLRFRCQVGHGYTAPALMSAKEGSVDEALRVALRVIEERAELVSRMAGDDRVHQP
SVASLYAARAKEYRGYADVLRSALLTSLQRPVEHGALVEDGALLTQEDQH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgacgattgaaaataaccgtaacatcgtggcgatcggcgggtcggcgggcgccagccag
gcgctgcgcacgctactggcagacctgccgcgcgatcttcccgccgcggtgctggtggtg
ctgcatctgtcgccgcaaggcacgggcatcgtagagatggtgcgcagcgcagtgcgcggc
ttgccggtgtacgtggccagtgatggcgtgcccttggtgccgggtgcggtgtatgtggcc
gtgccggactcccacctgatggtcgatggcatgcacgtcgtgctggggcgcgggccacgc
gagaacatgtcgcggccgtcgatcgatgccttgttccgctccgttgcggtctcacacggc
gcacgcgcgttgggggtgctgctgtcgggcatgctcaacgatggctgcgccgggttggaa
gccatccaggcctgcggtggcgcggtggcggtgcaggacccagacgatgcgatcgccgac
gacatgccgcgcaatgcgctgcgtgcgctcaccccggacgtggtggcacccagcgcggcc
ctgggtgcggtcatcaccgatctggtgcgcgaaccggcggcctggccgattgcgccgtcg
gatgcgctcaagctggaggtcgcgatcgcgcgcgggcagccgtccaccaccgaggtgatg
acgcagctgggggagccggtggcgctcagctgcccggcgtgtggcggggtgctgaccaag
ctgcatacaccggggacgctgcgttttcgttgccaggtcggtcatggctacaccgcgccc
gcactgatgtccgcaaaggaaggctcggtggatgaggcgctgcgcgtggccttgcgcgtg
atcgaagaacgcgccgaattggtgagccggatggccggggacgaccgcgttcaccagcca
tcggttgcctcgctgtatgccgcgcgtgccaaggaataccgcggctatgcggatgtgttg
cgcagcgccttattgacctcactgcagcgcccggtcgaacacggcgcgcttgtcgaagac
ggcgcgttgctgacgcaggaagatcagcattaa

DBGET integrated database retrieval system