KEGG   Xanthomonas campestris pv. campestris 8004: XC_2171Help
Entry
XC_2171           CDS       T00247                                 

Definition
(GenBank) strX protein
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00521  Streptomycin biosynthesis
xcb00523  Polyketide sugar unit biosynthesis
xcb01130  Biosynthesis of antibiotics
Module
xcb_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    XC_2171
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XC_2171
Enzymes [BR:xcb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     XC_2171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AAY49227
UniProt: A0A0H2X988
Position
2616338..2616919
Genome map
AA seq 193 aa AA seqDB search
MIFRPTPLSGAFIIEPEPRGDARGWFARVFCTQEMAQAGLVDQFVQVNNSFNAEAGTLRG
MHYQLPPAPEVKIVRCIRGALWDAIVDLRPDSPTYLQWYGVELTADNRLALYVPRGFAHG
FITLQAQTEALYFASAMYTPAAERGLRWDDARIGIRWPCTPALVSDKDAAWPEFNEQVHG
VTQLTGLTQQERA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatctttcgccccacgccgttgtctggcgccttcatcatcgagcccgaaccgcgaggc
gatgcgcgtggatggtttgcgcgggtgttctgtacccaggagatggcgcaggccgggctg
gtggaccagttcgtgcaggtcaacaattccttcaacgcagaggccggcaccttgcgcggc
atgcactatcagctgccgcccgcgccggaggtcaagatcgtgcgctgcatccgcggcgcg
ctgtgggatgccattgtcgacctgcgcccggattcgcccacctacctgcagtggtacggg
gtcgaactcactgccgacaaccgcctggcactgtatgtgccgcgcgggtttgcgcatggc
ttcatcacgctgcaggcgcagaccgaagcgctgtatttcgccagtgcgatgtatacgccg
gctgccgaacgcggactgcgctgggacgatgcgcgcattggcatccgctggccgtgcacg
cccgcattggtgtccgacaaggacgccgcctggccggagttcaatgagcaggtgcatggc
gtgacccaactgaccgggctgactcaacaggagcgcgcatga

DBGET integrated database retrieval system