KEGG   Xanthomonas campestris pv. campestris 8004: XC_2186Help
Entry
XC_2186           CDS       T00247                                 

Definition
exodeoxyribonuclease III
Orthology
K01142  
exodeoxyribonuclease III [EC:3.1.11.2]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:xcb03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2632800..2633870)
Genome map
AA seq 356 aa AA seqDB search
MPTTQRTIATYNVNGIASRLPHLLQWLQREQPDIVGLQELKSTQEAFPEQAIRDAGYGVI
WQGQRSWNGVALLARGAEPVEIRRGLPWDPADTQSRYLEAAIHGVIVGCLYLPNGNPQPG
PKFDYKLKWFQRLLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRA
AYAQLLAQGWTDSLQAIHGDAPVYTFWDYFRQHFARDRGLRIDHLLLNRTLAAGLRDAGV
GKWVRALEKASDHAPTWITVDVPDTDAVPAAAAGPARKRTKVKEAAANAGEKKPSATKKA
VKNAAKTTAVAKTAARKSATKKPVAKKASANTASAAAAAKKATPATTRKASKRPKA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccactcaacgtacgattgcgacctacaacgtcaatggcatcgccagccgcctg
ccgcacctgctgcaatggctgcaacgcgagcagccggatatcgtggggctgcaggaattg
aaatccacgcaggaggcatttccggaacaggcgatccgcgatgcgggctacggggtgatc
tggcagggccagcggtcctggaacggcgtggcactgctggcacgtggcgcggagccggta
gagatccggcgcggcctgccgtgggatccggcggacacgcagagccgctatctggaggcc
gccatccacggggtgatcgtgggttgcctgtacctaccgaatggcaacccgcaacccggg
ccgaagttcgactacaaattgaagtggttccagcgcctgctccggcatgcggccacgctg
gtggcgctgccacatccggttgcgttgatcggcgacttcaatgtggtgcccaccgatgcg
cacatctatgaccccaagggctggcgcaaggacgcattgctgcagccggagagccgcgcc
gcgtacgcgcagttgctggcgcagggctggaccgacagcctgcaggccatccacggcgat
gcaccggtctacacgttctgggattactttcgtcagcacttcgcgcgtgaccgcgggctg
cgcatcgatcatctcttgctcaaccgcacgttggcggcggggctacgcgatgcgggggtg
ggcaagtgggtgcgtgcgctggagaaggccagcgatcatgcgccgacctggatcacggtg
gatgtgccagataccgatgcagtgccagcagctgcggccgggcctgcacgcaagcgcacc
aaggtgaaggaggctgcggcaaatgcgggcgagaagaagccgtctgcgacgaagaaggcc
gtaaagaacgcagcgaagaccactgcggtcgccaagacagctgcaaggaagtctgccacc
aagaaaccagtagccaaaaaggcatcggcaaacaccgcatcagccgcagctgcagccaag
aaggcaacgcccgccacgacacgcaaggctagcaaacgtcccaaggcttaa

DBGET integrated database retrieval system