KEGG   Xanthomonas campestris pv. campestris 8004: XC_2186Help
Entry
XC_2186           CDS       T00247                                 

Definition
exodeoxyribonuclease III
Orthology
K01142  
exodeoxyribonuclease III [EC:3.1.11.2]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    XC_2186
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     XC_2186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2632800..2633870)
Genome map
AA seq 356 aa AA seqDB search
MPTTQRTIATYNVNGIASRLPHLLQWLQREQPDIVGLQELKSTQEAFPEQAIRDAGYGVI
WQGQRSWNGVALLARGAEPVEIRRGLPWDPADTQSRYLEAAIHGVIVGCLYLPNGNPQPG
PKFDYKLKWFQRLLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRA
AYAQLLAQGWTDSLQAIHGDAPVYTFWDYFRQHFARDRGLRIDHLLLNRTLAAGLRDAGV
GKWVRALEKASDHAPTWITVDVPDTDAVPAAAAGPARKRTKVKEAAANAGEKKPSATKKA
VKNAAKTTAVAKTAARKSATKKPVAKKASANTASAAAAAKKATPATTRKASKRPKA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccactcaacgtacgattgcgacctacaacgtcaatggcatcgccagccgcctg
ccgcacctgctgcaatggctgcaacgcgagcagccggatatcgtggggctgcaggaattg
aaatccacgcaggaggcatttccggaacaggcgatccgcgatgcgggctacggggtgatc
tggcagggccagcggtcctggaacggcgtggcactgctggcacgtggcgcggagccggta
gagatccggcgcggcctgccgtgggatccggcggacacgcagagccgctatctggaggcc
gccatccacggggtgatcgtgggttgcctgtacctaccgaatggcaacccgcaacccggg
ccgaagttcgactacaaattgaagtggttccagcgcctgctccggcatgcggccacgctg
gtggcgctgccacatccggttgcgttgatcggcgacttcaatgtggtgcccaccgatgcg
cacatctatgaccccaagggctggcgcaaggacgcattgctgcagccggagagccgcgcc
gcgtacgcgcagttgctggcgcagggctggaccgacagcctgcaggccatccacggcgat
gcaccggtctacacgttctgggattactttcgtcagcacttcgcgcgtgaccgcgggctg
cgcatcgatcatctcttgctcaaccgcacgttggcggcggggctacgcgatgcgggggtg
ggcaagtgggtgcgtgcgctggagaaggccagcgatcatgcgccgacctggatcacggtg
gatgtgccagataccgatgcagtgccagcagctgcggccgggcctgcacgcaagcgcacc
aaggtgaaggaggctgcggcaaatgcgggcgagaagaagccgtctgcgacgaagaaggcc
gtaaagaacgcagcgaagaccactgcggtcgccaagacagctgcaaggaagtctgccacc
aagaaaccagtagccaaaaaggcatcggcaaacaccgcatcagccgcagctgcagccaag
aaggcaacgcccgccacgacacgcaaggctagcaaacgtcccaaggcttaa

DBGET integrated database retrieval system