KEGG   Xanthomonas campestris pv. campestris 8004: XC_2386Help
Entry
XC_2386           CDS       T00247                                 

Definition
(GenBank) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XC_2386
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XC_2386
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    XC_2386
Enzymes [BR:xcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     XC_2386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2877529..2878836)
Genome map
AA seq 435 aa AA seqDB search
MMFISTRGAAPAVSLSQGIAAGLAPDGGLYVPQTLPPARTLQAGATLADTATTLLQPFFE
GDALAGELAAICAEAFDFPAPLVPLATPGDYALELFHGPTAAFKDFGARFLAACLTRLRR
AEDRPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQALR
VAGTFDDCQAMVKQALNDGELQVQVPLSSANSISLGRLLPQMSYYAHAALQHHAGSGAAL
NLVVPTGNLGNGLAAILARALGVPLGQIVLASNANHVLPDYFAGDDYAPQPSVATVANAM
DVGAPSNFERLRWLYDGDDAALREAFRALSVDDTAIRHTVQQRFARYGEVHCPHTATAVH
VLEQLRAEGPEGGTGDWAVAATAHPAKFEAVVEPLIGRAVEIPPALAALLQRPAHAEPLA
PDYQAFRQRLLADAP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcatctctacccgtggcgccgcacctgccgtgagcctgagccaggggatcgcc
gccggcctggccccggatggcggcctttacgtgccgcagaccctgccgccggcgcgcacc
ctgcaggcaggcgcaacgctggccgacacggccaccacactgctgcagccgttcttcgag
ggcgacgcgctggcaggcgagctggcggccatctgcgccgaagcgttcgatttcccggcg
ccgctggtgccgctggccacgccgggcgactacgcgctggagctgttccatggccccacc
gcagccttcaaggattttggtgcgcggtttctggccgcttgcctgacccggctgcggcgc
gccgaagaccgcccgctgaccattctggtggccacctccggcgataccggcgcggccgtg
gcggcggcgttccatcggcagcccggcctgcgggtggtggtgctgtatccggatggccgc
gtgtcgccacggcaggcgcatcagctgggctgcttcggcgacaacatccaggcattgcgt
gtggccggcacctttgacgactgccaggccatggtcaagcaggccttgaacgatggcgag
ctgcaggtgcaggtgccgctgagttcggccaatagcatcagcctggggcggctgctgccg
cagatgagctactacgcgcacgcagcgctgcagcaccacgctggctccggggccgcattg
aacctggtggtgcccaccggcaacctgggcaacggcttggccgcgatcctggcacgcgcg
ctcggcgtgccgctgggccagatcgtgctggcgtccaacgccaaccatgtattgcccgac
tacttcgccggcgacgactacgccccgcaacccagcgtggctaccgtggccaacgcgatg
gacgtgggcgcgcccagcaatttcgaacgcctgcgttggctgtatgacggcgacgatgcg
gcgctgcgcgaggcgttccgtgcgctgtcggtggatgacacggcgatccgccacaccgtg
cagcaacgcttcgcacgctacggcgaagtgcattgcccgcataccgccaccgccgtgcac
gtactggagcaattgcgtgcggaagggcccgagggcggcactggcgactgggcggtggcg
gccacggcgcacccggccaaattcgaggcggtggtggagccactgatcggccgcgcagtg
gagatcccgccagcgctggcggcgctgttgcagcgcccggcgcatgccgaaccgctggca
ccggactaccaggcgttccggcagcgtctgctcgcggatgcgccctga

DBGET integrated database retrieval system