KEGG   Xanthomonas campestris pv. campestris 8004: XC_2386Help
Entry
XC_2386           CDS       T00247                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00260  Glycine, serine and threonine metabolism
xcb00750  Vitamin B6 metabolism
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01230  Biosynthesis of amino acids
Module
xcb_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XC_2386
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    XC_2386
Enzymes [BR:xcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     XC_2386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AAY49439
UniProt: A0A0H2X840
Position
complement(2877529..2878836)
Genome map
AA seq 435 aa AA seqDB search
MMFISTRGAAPAVSLSQGIAAGLAPDGGLYVPQTLPPARTLQAGATLADTATTLLQPFFE
GDALAGELAAICAEAFDFPAPLVPLATPGDYALELFHGPTAAFKDFGARFLAACLTRLRR
AEDRPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQALR
VAGTFDDCQAMVKQALNDGELQVQVPLSSANSISLGRLLPQMSYYAHAALQHHAGSGAAL
NLVVPTGNLGNGLAAILARALGVPLGQIVLASNANHVLPDYFAGDDYAPQPSVATVANAM
DVGAPSNFERLRWLYDGDDAALREAFRALSVDDTAIRHTVQQRFARYGEVHCPHTATAVH
VLEQLRAEGPEGGTGDWAVAATAHPAKFEAVVEPLIGRAVEIPPALAALLQRPAHAEPLA
PDYQAFRQRLLADAP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcatctctacccgtggcgccgcacctgccgtgagcctgagccaggggatcgcc
gccggcctggccccggatggcggcctttacgtgccgcagaccctgccgccggcgcgcacc
ctgcaggcaggcgcaacgctggccgacacggccaccacactgctgcagccgttcttcgag
ggcgacgcgctggcaggcgagctggcggccatctgcgccgaagcgttcgatttcccggcg
ccgctggtgccgctggccacgccgggcgactacgcgctggagctgttccatggccccacc
gcagccttcaaggattttggtgcgcggtttctggccgcttgcctgacccggctgcggcgc
gccgaagaccgcccgctgaccattctggtggccacctccggcgataccggcgcggccgtg
gcggcggcgttccatcggcagcccggcctgcgggtggtggtgctgtatccggatggccgc
gtgtcgccacggcaggcgcatcagctgggctgcttcggcgacaacatccaggcattgcgt
gtggccggcacctttgacgactgccaggccatggtcaagcaggccttgaacgatggcgag
ctgcaggtgcaggtgccgctgagttcggccaatagcatcagcctggggcggctgctgccg
cagatgagctactacgcgcacgcagcgctgcagcaccacgctggctccggggccgcattg
aacctggtggtgcccaccggcaacctgggcaacggcttggccgcgatcctggcacgcgcg
ctcggcgtgccgctgggccagatcgtgctggcgtccaacgccaaccatgtattgcccgac
tacttcgccggcgacgactacgccccgcaacccagcgtggctaccgtggccaacgcgatg
gacgtgggcgcgcccagcaatttcgaacgcctgcgttggctgtatgacggcgacgatgcg
gcgctgcgcgaggcgttccgtgcgctgtcggtggatgacacggcgatccgccacaccgtg
cagcaacgcttcgcacgctacggcgaagtgcattgcccgcataccgccaccgccgtgcac
gtactggagcaattgcgtgcggaagggcccgagggcggcactggcgactgggcggtggcg
gccacggcgcacccggccaaattcgaggcggtggtggagccactgatcggccgcgcagtg
gagatcccgccagcgctggcggcgctgttgcagcgcccggcgcatgccgaaccgctggca
ccggactaccaggcgttccggcagcgtctgctcgcggatgcgccctga

DBGET integrated database retrieval system