KEGG   Xanthomonas campestris pv. campestris 8004: XC_2433Help
Entry
XC_2433           CDS       T00247                                 

Definition
(GenBank) ATPases of the AAA+ class
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA AAA_22 AAA_16 Zot NACHT AAA_33 PhoH Dak2 TsaE 6PF2K
Motif
Other DBs
NCBI-ProteinID: AAY49483
UniProt: A0A0H2X8D6
Position
2946830..2947726
Genome map
AA seq 298 aa AA seqDB search
MSQTGVFDAKIVLTDPKLSAREKTLLGFEARFSKIHRQLRLLLNLGQLDVWSKTHHKAKL
PLCELVAEQYPLVIFHGDVGTGKTATAECVANRLAKESKTEDAQLFRLSNRVRGGGKVGE
MGTLLTQAFHEVVQSAGKNRRAFLIIDEGDSIAASRNQDHSHHEDKVAVNTLIQGVDDLR
SHGGRVVVFLCTNRLSVLDAALRRRAAVVEMFTRPNDAERRELLNMDLSGLGLAPKQIEQ
LVMTTGPQGQQPGWTFSDIRTRLYPAALAQAFPDRALSFEDFYSAASALRPSPIMEDK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagaccggagtatttgacgccaagatcgttctgacggacccgaaactctctgct
cgtgagaagacgcttcttggcttcgaagcacgcttttccaagatccacaggcagcttcgc
ttgttgctgaacttgggacagctcgatgtatggagcaagacgcaccataaggccaagtta
ccgctgtgcgagcttgttgctgagcagtatccgttagtcatttttcatggcgatgtcggc
acggggaaaaccgcaacagcagagtgcgtggccaatcgcttggcaaaagaatcaaagacc
gaggacgcgcagctgttccgactgagcaatcgcgttcgaggtggcggcaaggtcggtgag
atgggcacgctgctgacccaagcttttcacgaggtcgtgcaatcggccggaaagaaccga
cgcgcgtttctcatcatcgatgaaggcgactccattgcggcctcgcgcaatcaagaccac
agtcatcatgaagacaaagtggcggtgaacacgctcatccaaggtgtagatgacttgcgc
tctcatggcggacgcgtggttgtttttttgtgcaccaaccgcctttcggtgctcgacgcc
gcacttcgtcgccgggctgctgttgttgagatgttcactcgacctaacgatgctgagcga
cgggagctccttaacatggacctgagcggcttgggacttgcgccaaagcaaatcgagcag
ctggtcatgaccacaggcccgcagggccaacagcctggctggaccttctcggacattcgc
acacggctttatcctgccgccttggcacaggcatttcccgatcgcgcgttgagctttgaa
gatttttacagtgcggcaagcgcgcttcgcccctccccgatcatggaggacaagtga

DBGET integrated database retrieval system