KEGG   Xanthomonas campestris pv. campestris 8004: XC_2438Help
Entry
XC_2438           CDS       T00247                                 

Definition
(GenBank) plasmid-related protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY49488
UniProt: A0A0H2X8E0
Position
complement(2951315..2952016)
Genome map
AA seq 233 aa AA seqDB search
MKARPCSHKVKASQEGCSAALTMRFAIGQSAKMNFDPRAIAVVDRFDEDQEPVVLEMLDP
VWFGYIERFIKKSALGTKEDALVVRKLQELALQKRWLVCGCRGMHSTNSPVFFPKQVPNG
AIRKATMVHLYDRPSHHPDCKLSRERPLSLGGISGLPRIKKVRGLAVLKAMGLGGFAVAS
YKHQPAERMSHAQKMPTLARVLFTVLEGASLNRIGHCDEAHQRPDESVVLLPR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcgagaccctgttcgcacaaagtaaaagccagccaagaaggttgtagcgccgca
ttgacgatgcgctttgccattgggcaaagtgcgaagatgaactttgatcccagagctatc
gctgtcgttgatcgttttgatgaagaccaagagccggttgtgcttgaaatgcttgacccg
gtttggtttggctacatcgaacgctttattaaaaaaagcgctcttgggacgaaggaagat
gcgctagtcgtgcgcaagcttcaagagctggctttgcagaagcgctggctggtctgtggg
tgccgagggatgcattccacaaactcccctgtcttcttccccaagcaagtgcccaacggc
gccattcgaaaagcgacgatggtgcacctctacgatcgcccgtcacatcatccggactgc
aaattatcgcgagagcggcccttgtcattgggcggtatttcaggccttccgcgtatcaag
aaggttagggggcttgcggtcttaaaggccatgggactaggaggtttcgctgtcgcgagt
tataagcatcagccagcggagcgaatgagtcacgcccagaagatgccaacactggcgcgg
gttctgttcactgtgttggaaggagcatcactcaatcgaattgggcattgtgacgaagcc
catcagcgaccagatgaaagcgttgtcctcttacctcgataa

DBGET integrated database retrieval system