KEGG   Xanthomonas campestris pv. campestris 8004: XC_2443Help
Entry
XC_2443           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KAP_NTPase AAA_16 AAA_22 ArgK Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AAY49493
UniProt: A0A0H2X8E4
Position
complement(2956010..2957863)
Genome map
AA seq 617 aa AA seqDB search
MDMWADNETERDFLNFSGIADTVAEIIAQANGRPVSIGVSGSWGVGKSSMIKLTHASLSA
RPRQEGDREFVVVEFNAWLYQGYDDARAALMDVIADKLAEEAKKRETAGDKVTEFVKRIR
WLRLGKLVATDVAALTLGLPPIGILGGVFNTAGDMADGVNEDELKAADKAVKKAGKEVAG
LLDPRLEISPPKEIQALRNSFEQALEELGITLVVLIDDLDRCLPPTTISTLEAIRLFLFL
RHTAFVIAADDGMIKHAVRRHFDGITDDLVINYFDKLIQVPIRVPPLGTQEVRAYMMLLF
VDNSSLDQEDKNKIRLGVCEQLRKTWQGNRVDRGFVAGLHPDLPGELVGKLDTADRLAPL
MVSASGILGNPRLIKRFLNALSIRMAISNAQGVGVDEAVLAKLMLFERLGDSKAFADLVS
KVSTSDNGKPAFLAEWEKSAIAGAEFALQDPWKAPFIEEWLRLPPALSDIDLRGALYVSR
EHAPLISPEDRLSSDAAEVLTALLTQPEMAGSLKARLSGLARAETTVLMDRVLEKARQEQ
EWGVPAILESAVALAESDPALGARLAAFLRDRPVAQIRPNIIPRIADYSWAKDVFGAWDA
GDTSKPVKAAIKTRTVK
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
gtggacatgtgggctgacaacgagacagagagagattttcttaacttctctggaatcgca
gatacggttgcagagatcatcgcgcaggccaacgggcgcccagtatcgattggggtatcg
ggatcatggggtgtgggcaagtcttctatgattaagcttacccatgcctcgctctccgcc
cggccgagacaggaaggcgatagagaattcgtcgtcgttgaattcaatgcgtggctgtac
caaggctatgatgacgcgcgtgctgcactcatggatgtcatcgcggataaacttgcggaa
gaagccaagaagcgtgagacggcgggggataaggtcacggaattcgtcaagaggatccgg
tggcttcgccttggcaagctcgtggcgaccgatgtggcggcattgacattggggttgccg
ccaattggcattcttggcggggtgttcaatactgccggggatatggccgatggagtcaac
gaggatgagttgaaggctgccgataaagcagtcaagaaggcaggaaaggaagtcgctggt
ctattggaccctcgactcgaaatctcgccaccaaaggaaattcaagcgctacgcaacagc
tttgaacaggcgctagaagagctaggaattacgctggttgttctgatagacgatctcgat
cggtgcttaccgccgacgacgatctctaccttagaagcaatccgattgtttctatttctt
cgccacaccgcattcgtgatcgcagcggatgatggcatgatcaagcatgccgtcaggcgc
cactttgacggcatcaccgatgacctagtcatcaactatttcgataaactgattcaggtt
cccatccgcgttccacctttgggcacccaggaagttcgcgcttacatgatgctattgttc
gtagacaacagtagcttggatcaagaagataagaataagatccgtttgggtgtatgcgag
caattgcggaagacatggcagggcaatcgggtggatcgaggtttcgttgcaggtctgcat
ccggatttgccaggcgaacttgtcggtaagctagacacggctgaccggctcgcgcccttg
atggttagcgcatcgggaattttgggcaacccacgtctgatcaagcgctttctaaacgca
ctctccatccggatggccatttccaacgcgcaaggcgttggtgttgacgaagcagtattg
gccaagctgatgttgtttgagcggctgggggacagtaaggctttcgcagatttggtgtcc
aaggtgagcaccagcgacaacggaaagccagcgttcctcgcggagtgggaaaaatccgca
attgcaggtgccgagtttgctcttcaagatccctggaaggcgccgttcatcgaagagtgg
ttgcgactgcctcctgcactatcagatattgatttgcgtggggctctctacgtaagtcgt
gagcatgcgccgctaatctcacccgaggaccgcttgtcgtcggatgccgccgaagttctc
accgctttgcttactcagccggagatggcaggcagcttgaaggcgcgcctatctggctta
gctcgggcagagacgaccgtgctaatggatcgcgtgttagagaaggcgcgccaggagcag
gaatggggcgttcctgccattcttgaatctgccgtggcgctggctgagtccgaccctgcg
ctgggagcgcgcctagctgcgtttctgcgagatcgacctgtagctcagatccgtccaaac
atcattccgagaatcgcagattactcttgggcgaaagacgtattcggcgcttgggacgct
ggggacacgagtaagcctgtaaaggcagccatcaaaacaaggacagtcaagtag

DBGET integrated database retrieval system