KEGG   Xanthomonas campestris pv. campestris 8004: XC_2445Help
Entry
XC_2445           CDS       T00247                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00010  Glycolysis / Gluconeogenesis
xcb00053  Ascorbate and aldarate metabolism
xcb00071  Fatty acid degradation
xcb00280  Valine, leucine and isoleucine degradation
xcb00310  Lysine degradation
xcb00330  Arginine and proline metabolism
xcb00340  Histidine metabolism
xcb00380  Tryptophan metabolism
xcb00410  beta-Alanine metabolism
xcb00561  Glycerolipid metabolism
xcb00620  Pyruvate metabolism
xcb00625  Chloroalkane and chloroalkene degradation
xcb00903  Limonene and pinene degradation
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XC_2445
   00053 Ascorbate and aldarate metabolism
    XC_2445
   00620 Pyruvate metabolism
    XC_2445
  Lipid metabolism
   00071 Fatty acid degradation
    XC_2445
   00561 Glycerolipid metabolism
    XC_2445
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XC_2445
   00310 Lysine degradation
    XC_2445
   00330 Arginine and proline metabolism
    XC_2445
   00340 Histidine metabolism
    XC_2445
   00380 Tryptophan metabolism
    XC_2445
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XC_2445
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XC_2445
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XC_2445
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     XC_2445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAY49495
UniProt: A0A0H2X8B6
Position
2958759..2960417
Genome map
AA seq 552 aa AA seqDB search
MSHVRPACQAGGWCGEPAKIGGYSRCVSPGAGCGRPDFLGDSMSADLLKALDLAPSNAGT
YLGEGTWSQATGAGVLQPLNPTTNAVIADVQATTPQDYELIVARAQAAFKVWRTTPAPRR
GEAVRLCGEALRAHKDALGSLVALEMGKSKPEGDGEVQEMIDIADFAVGQSRMLYGYTMH
SERPGHRMYEQYQPLGLVGIISAFNFPVAVWAWNAFLAAICGDICIWKPSNKTPLTAIAT
MKICNAALKEAGFPDIFFLINDAGTSLSEKLVEDGRVPLISFTGSTQIGRVVAEKVARRL
GRCLLELGGNNAIILDETADLKLAVPGIVFGAVGTAGQRCTTTRRLIVHESIYDNVLATL
VKAYKQLDSKIGDPTDPANLMGPLNSRGAVEQFLESIAKAKAAGGTVEVGGTAIDRPGNF
VLPAIVTGLKNSDAVVQHETFAPILYVMKYSTLDEAIDLQNGVPQGLSSSIFTQNLKAAE
KFLSAAGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKVYMRRQTNTINYSD
SLPLAQGIKFDL
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcatgttcgtccggcttgccaagccggcgggtggtgcggggagcctgctaaaatc
ggcggctactcgcgttgcgtctcgcctggtgcgggctgcggccgtcccgactttcttgga
gattccatgtccgctgacctgctcaaggcgctcgacctcgccccgtccaatgccggcacc
tatcttggcgaggggacctggtcgcaggccaccggtgccggggtgctgcagccgctcaat
ccgaccaccaatgcggtgatcgccgatgtgcaggccaccacgccgcaggactacgagctg
atcgtggcgcgcgcacaggcggccttcaaggtctggcgcaccaccccggcgccgcgtcgt
ggcgaggccgtgcgcttgtgcggcgaggcactgcgtgcgcacaaggacgcgctcggttcg
ctggtggcgctggaaatgggcaagagcaagcccgaaggcgatggcgaggtgcaggagatg
atcgacatcgccgacttcgccgtgggccagagccgcatgctgtacggctacaccatgcac
tcggagcgcccgggccaccgcatgtacgagcagtaccaaccgctgggcctggtcggcatc
atcagtgcgttcaacttcccggtggcggtgtgggcgtggaatgcgttcctggcggccatt
tgcggcgatatctgcatctggaagccgtccaacaagaccccgctgaccgcgatcgccacg
atgaagatctgcaatgccgcgctcaaggaagccggcttcccggacatcttcttcctgatc
aacgatgccggcacctccctgtcggagaagctggtcgaagacggacgcgtgccgctgatc
agcttcaccggctcgacccagatcggccgcgtggtcgccgagaaggtcgcccgccgcctg
ggccgctgcctgctggagctgggcggcaacaacgccatcatcctggatgaaaccgccgac
ctgaagctggcggtgccgggcatcgtgttcggcgcggtgggcaccgccggccagcgctgc
accaccacgcgccggctgatcgtgcacgaatccatctacgacaacgtgctggccacgctg
gtcaaggcgtacaagcagctcgacagcaagatcggcgaccccaccgacccggccaacctg
atgggcccgctcaacagccgcggtgcggtggagcagttcctggagtccatcgccaaggcc
aaggccgccggcggcacggtcgaagtgggcggcaccgcgatcgatcgccccggcaatttc
gtgctgccggcgatcgtgaccgggctgaagaacagcgacgcggtggtgcagcacgagacc
ttcgcgccgatcctgtacgtgatgaagtacagcacgctggacgaggcgatcgatctgcag
aacggcgtgccgcagggcctgtcgtcgtcgatcttcacccagaacctgaaggcggccgag
aagttcctgtcggcggccggcagcgactgcggcattgccaacgtcaatatcggcacttcg
ggtgcggagatcggcggcgcgttcggtggcgagaaggaaaccggcggcggtcgcgaatcc
ggctcggatgcgtggaaggtctacatgcgccgccagaccaacaccatcaactactccgat
tcgctgccgctggcgcaaggcatcaagttcgacctttga

DBGET integrated database retrieval system