KEGG   Xanthomonas campestris pv. campestris 8004: XC_2454Help
Entry
XC_2454           CDS       T00247                                 

Definition
(GenBank) phosphatidylglycerophosphatase B-related protein
  KO
K19302  
undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XC_2454
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     XC_2454
Peptidoglycan biosynthesis and degradation proteins [BR:xcb01011]
 Precursor biosynthesis
  Diphosphatase
   XC_2454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2967265..2967996)
Genome map
AA seq 243 aa AA seqDB search
MSVGPAESPTGFKTWLQRNAWRFGLLFAGVLLPLGLFVDLADEVHELENFYFDEPLLWSL
RSIASPGLDAFFSIVSKVGYQYGVIPLDIAIVLVLLVLRRWREGTFAALGFVGSALLNLG
AKQFFQRHRPSLWESIAPESTFSFPSGHAMGSMTLAAVVIALAWRTRWRWPVTSVAGLFA
LLVGVSRIYLGVHYPSDILGGWSAALVWVVGLYLVMFRGMRRPHWRTPSGAVVERPGRVP
FAD
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgggccggctgagtcgccgaccggattcaagacctggctgcagcgcaatgcg
tggcggttcggcctgctgtttgcgggcgtgctgctgccgctgggattgttcgtcgacctc
gccgacgaagtgcatgagctggaaaacttctatttcgacgaaccgttgctgtggagcctg
cgcagcattgcctcgccggggctggatgcgttcttcagcatcgtctctaaagttggttac
cagtacggcgtgatcccgctggatatcgcgatcgtgctggtgttgctggtgctgcggcgc
tggcgcgaaggcaccttcgccgcgcttgggtttgtgggctcggcgttgctcaacctgggc
gccaagcagttctttcagcggcaccggcccagcctgtgggaatcgatcgccccggaaagc
actttcagctttcccagtggccacgcgatgggctcgatgaccctggcggccgtggtgatt
gcattggcgtggcgtacgcgttggcgctggccggtgaccagtgttgccggcctgttcgcg
ctgctggtcggtgtctcgcgcatctacctgggcgtgcattatccctccgacatcctcggc
ggctggtcggctgcattggtgtgggtggtgggcctgtatctggtgatgtttcgcggtatg
cggcgcccgcattggcgcacgccgagcggggcggtggtggagcggcccgggcgcgtgccg
ttcgctgattaa

DBGET integrated database retrieval system