KEGG   Xanthomonas campestris pv. campestris 8004: XC_2455Help
Entry
XC_2455           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03526  
(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XC_2455
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.1  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (ferredoxin)
     XC_2455
    1.17.7.3  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin)
     XC_2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2967977..2969242)
Genome map
AA seq 421 aa AA seqDB search
MYDAVTRPSPPADASAWPRRITQAVKVGNVIVGGGHPVVVQSMTNTDTADIAGSVKQVAE
LWRAGSEMVRLTVNNAESAAAIPRIVEKLRMMGIEVPLIGDFHYNGHQLLTAEPACAEAL
AKYRINPGNVGFGKKKDLQFAQLIEFAIQYDKPVRIGANWGSLDQALAAQLMDENSKRET
PWDAGRVLREALIRSAVDSAERAVELGLPRERIILSAKVSGVQELIAVYRDMAARCDFAL
HLGLTEAGIGSKGIVASAAALSVLLQEGIGDTIRISLTPEPGQSRTQEVIVAQELLQTTG
QRAFTPLVTACPGCGRTTSEFFQELAGVVQNHVRAKMPEWKISNPGAENMTLAVMGCVVN
GPGESRHANIGISLPGTGEAPSAPVFVDGEKTVTLRGENIAYEFIDLIDQYVERTYVRRA
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgccgtcacccgcccaagtccccccgccgatgccagcgcctggccgcgccgc
atcacccaggccgtcaaggtcggtaacgtcattgtgggcggaggccatccggtggtcgtc
cagtcgatgaccaataccgacactgccgacatcgccggcagcgtcaagcaggtcgccgag
ttgtggcgggccggctcggaaatggtgcgcctgaccgtgaacaatgccgagtcggcagcg
gccatcccgcgcatcgtcgagaagctgcgcatgatgggcatcgaagtgccgttgatcggc
gacttccactacaacggccaccagctgctcacggccgaaccggcctgcgccgaggcgctg
gccaaataccgcatcaatccgggcaacgtgggcttcggcaagaagaaggacctgcagttt
gcgcagttgatcgaattcgccatccagtacgacaagccggtgcgcatcggcgccaactgg
ggctcgctggaccaggcgttggccgcgcagctgatggacgaaaattccaagcgcgagacg
ccgtgggatgcgggccgggtgctgcgcgaagcgctgatccgctcggcggtggattcggca
gaacgcgccgtggaactgggcttgccgcgcgagcgcatcatcctgtcggccaaggtgtcc
ggcgtgcaggaattgatcgcggtgtaccgcgacatggccgcgcgctgcgacttcgcgctg
cacctgggtctgaccgaggccggtatcggcagcaagggcatcgtggcctcggcagcggcg
ctgagcgtgctgctgcaggaaggcatcggcgacaccatccgcatttcgctgacgcccgaa
ccgggacagtcgcgcacgcaggaagtgatcgtcgcgcaagagctgctgcaaaccaccggg
cagcgtgcgttcacgccgctggtcaccgcctgccccggctgcggccgtactacctcggag
tttttccaggagctggccggcgtggtgcagaaccatgtgcgcgccaagatgccggaatgg
aagatcagcaaccccggcgcagaaaacatgacgctggcggtgatgggctgcgtggtcaat
gggccgggtgaatcgcgacacgccaacatcggtatctcgctgccgggcactggcgaagcg
ccctcggcaccggtgttcgtggatggcgaaaagaccgtcaccctgcgcggcgagaacatc
gcctacgaattcatcgacctgatcgaccagtacgtcgaacgcacctatgtccgtcgggcc
ggctga

DBGET integrated database retrieval system