KEGG   Xanthomonas campestris pv. campestris 8004: XC_2456Help
Entry
XC_2456           CDS       T00247                                 

Definition
(GenBank) two-component system sensor protein
  KO
K15011  
two-component system, sensor histidine kinase RegB [EC:2.7.13.3]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Two-component system
Module
RegB-RegA (redox response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XC_2456
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     XC_2456
Protein kinases [BR:xcb01001]
 Histidine protein kinases
  Other families
   XC_2456
Two-component system [BR:xcb02022]
 Other families
  RegB-RegA [MD:M00523]
   XC_2456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2969361..2970590
Genome map
AA seq 409 aa AA seqDB search
MMNTSDASFLRTLCSLRWLATAGQAATILVASGLMGLTLPQEPLWAGVAALAVFNLYAQL
RVAHRGAVSPATEFGHILVDVTVLTWMVGWSGGIANPFGSLFLVLIALAALALPLSWAMA
VAAACVAGYVISAAFGLPLPYGGFDPLTLHMWGMAANFLLSTVVVLVFATRLALSLRERE
REISTLRERFARNEGIVALATHAASVAHELNTPLATMTLLADDIADQCDQVELREDLETL
RELLVQCHERVLALAAPADNGHLSREVAVRDVLEQWRLVRPTIELRRNEDAPLRLMLQPG
VSHLLMVLLNNAADAGERAGRPLIDLTLRVEDDQLVGEVRDYGLGFDTSQAMLPGTLFNS
GKPDGMGVGLALSHATVERLQGELWMLPAEGSGARVGFRLPLSEHEALA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaatacctccgacgcctccttcctgcggaccctgtgcagcctgcgctggctggcc
accgccggccaggccgccaccatcctggtcgccagcgggctcatgggcctcaccctgccg
caggagccgctctgggccggggtggccgcgctggcggtgttcaacctgtatgcgcagttg
cgggtggcgcaccgcggcgcggtcagcccggccaccgagttcggccacatcctggtcgat
gtgacggtgctgacctggatggtgggctggagcggcggcatcgccaacccgttcggttcg
ctgttcctggtgctgatcgcgctggccgcgctcgccctgccgctgagctgggcgatggcg
gtggcggcggcctgcgtggccggctacgtcatcagcgccgcattcggcttgccactgccg
tacggcggcttcgacccgttgaccctgcacatgtggggcatggcggccaacttcctgctt
tccaccgtggtggtgctggtgttcgccacccggctggcgttgtcgctgcgcgagcgcgaa
cgcgagatctccacactgcgcgagcgctttgcacgcaacgaaggcatcgtggcgctggcc
acgcatgccgcctcggtggcgcatgagctcaacaccccgctggcgacgatgaccctgctg
gccgacgacatcgccgaccagtgcgatcaggtcgagctgcgcgaagacctggaaaccctg
cgcgagctgttggtgcaatgccacgagcgcgtgcttgcgctggccgcaccggccgacaac
ggccatctcagccgcgaggtggcggtgcgcgatgtgctggaacagtggcgcctggtgcgc
ccgaccatcgagctgcgccgcaatgaagacgcgccgctgcggctgatgctgcagcccggc
gtgagccacctgttgatggtgctgctcaacaacgccgccgatgccggcgaacgcgccggc
cggccgctgatcgacctcaccctgcgcgtggaagacgaccaactggtcggcgaagtgcgc
gactacgggctgggcttcgacacctcgcaggcgatgttgccgggcaccttgttcaacagc
ggcaagcccgacggcatgggcgtgggactggccctgtcgcatgccaccgtcgagcggctg
cagggtgaactgtggatgcttcccgccgaaggcagcggcgcccgcgtcggtttccgcctg
ccgctctccgaacacgaggcccttgcatga

DBGET integrated database retrieval system