KEGG   Xanthomonas campestris pv. campestris 8004: XC_2457Help
Entry
XC_2457           CDS       T00247                                 

Definition
(GenBank) two-component system regulatory protein
  KO
K15012  two-component system, response regulator RegA
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb02020  Two-component system
Module
xcb_M00523  RegB-RegA (redox response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XC_2457
Two-component system [BR:xcb02022]
 Other families
  RegB-RegA [MD:M00523]
   XC_2457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HTH_8 HTH_30 HTH_29 HTH_28 HTH_1 HTH_23 HTH_Tnp_ISL3 HOIP-UBA
Motif
Other DBs
NCBI-ProteinID: AAY49507
UniProt: A0A0H2XA17
Position
2970587..2971162
Genome map
AA seq 191 aa AA seqDB search
MSTPIRTGLLVDDDTLYLRTLQRSLARRGVETLTATDAASALSTARSALPDFALIDLKLG
HDSGLNLIQPLREIRPDMRILLVTGYASIATAVEAIKLGADDYLPKPANIPTIMRALGEE
DDDLPDPDEEETAQEMMTPLSRLQWEHIQQALHETGGNVSAAARLLGMHRRSLQRKLTKR
PSPGPQREPGR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcccatccgcaccggcctgctggtcgacgacgacaccctgtatctgcgcacc
ttgcaacgcagcctcgcccgccgcggcgtggaaacgctcaccgccaccgatgcggccagc
gccttgtccaccgcacgcagcgcgctgccggacttcgccttgatcgatctgaagctgggc
cacgactcgggattgaacctgatccagccgctgcgcgagatccgcccggacatgcgcatc
ctgctggtcaccgggtacgcgagcatcgccaccgcggtggaggcgatcaagctcggcgcc
gacgactacctgcccaagccagccaacatccccaccatcatgcgtgcgctgggcgaagag
gacgacgacctgcccgatccggacgaagaagaaaccgcgcaggaaatgatgaccccgctc
agccgcctgcagtgggagcacatccagcaggcgctgcacgaaaccggcggcaacgtgtcc
gccgccgcgcgcctgctgggcatgcaccgccgctcgctgcagcgcaagctcaccaagcgc
ccgagcccgggaccgcagcgcgagcccgggcgctga

DBGET integrated database retrieval system