KEGG   Xanthomonas campestris pv. campestris 8004: XC_2467Help
Entry
XC_2467           CDS       T00247                                 

Definition
(GenBank) pantoate-beta-alanine ligase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00410  beta-Alanine metabolism
xcb00770  Pantothenate and CoA biosynthesis
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
Module
xcb_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XC_2467
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    XC_2467
Enzymes [BR:xcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     XC_2467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase
Motif
Other DBs
NCBI-ProteinID: AAY49517
UniProt: Q4UTV6
Position
complement(2984375..2985229)
Genome map
AA seq 284 aa AA seqDB search
MIQTITDLSALRALVTGWKREGLRVALVPTMGNLHAGHYSLVMLARQYADRVVSSVFVNP
TQFGPNEDFARYPRTPEADMRGLEDAGCDALWLPDVDTMYPLGTALATPIHAPGVSDVLE
GVCRPGHFDGVCTVVARLFNQVQPDVAAFGKKDYQQLAVIRQMVADLAFPIEILGGSIVR
EADGLAMSSRNQYLSADDRPISAQIRKVLLQMRDSHAAGVPRLQVEAAATQALEAVGFRV
DYTALRLPDLSEPDDGASNPAAGPRVALIAARIGSTRLIDNLEF
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgatccagaccattaccgatctgtcggcgctgcgcgcactggtcaccggctggaagcgc
gaggggctgcgcgtggcgctggtgcccaccatgggcaacctgcacgccgggcactattcg
ctggtgatgctggcgcgccagtacgccgaccgcgtggtctccagcgtgttcgtcaatccg
acccagttcggccccaatgaagacttcgcacgctacccgcggacgcccgaagccgacatg
cgtgggcttgaggatgccgggtgcgacgcgctgtggttgccggacgtggataccatgtat
ccgctcgggaccgcgctagccacgccgatccatgcacccggtgtcagcgacgtgctcgaa
ggcgtctgccggccgggccacttcgatggcgtctgcacggtggtggcgcgtctgttcaat
caggtgcagccggacgtggctgccttcggcaagaaggattatcagcagctggcggtgatc
cggcagatggtggccgacctggcgtttccgatcgaaatcctgggcggcagcatcgtgcgc
gaggccgatggcctggcgatgagctcgcgcaatcagtatctgtcggccgacgatcgcccg
atctcggcacagatccgcaaggtgctgctgcagatgcgcgacagccatgccgccggcgtg
ccgcgcctgcaggtcgaggcggcggcaacccaggcactggaagcggtgggtttccgtgtc
gactacaccgcgctgcgcctgcctgatctgagcgagcccgacgacggtgccagcaacccg
gcagccggcccacgcgtggcgctgatcgctgcccggatcggcagcacccggctgatcgac
aacctggaattctga

DBGET integrated database retrieval system