KEGG   Xanthomonas campestris pv. campestris 8004: XC_2468Help
Entry
XC_2468           CDS       T00247                                 

Definition
(GenBank) 3-methyl-2-oxobutanoate hydroxymethyltransferase
  KO
K00606  3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00770  Pantothenate and CoA biosynthesis
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
Module
xcb_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    XC_2468
Enzymes [BR:xcb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     XC_2468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_transf PEP_mutase Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AAY49518
UniProt: Q4UTV5
Position
complement(2985226..2986041)
Genome map
AA seq 271 aa AA seqDB search
MSSHADSKPWTVPALAQAKRDGRKLVMLTAYDAGFARTFDANGVDLILVGDSLGMVVQGH
ESTLPVTTADMVYHTAAVARVLERALLVADLSFQADATPERALDAATQLLQAGAEMVKIE
GAGHKLDVIRYLVEREIPVCSHLGLTPQSVLRFGGYKVQGRGEAGEQLRRDAQAAVDAGA
SLIVLECVPTPIAAQISAELRVPTIGIGAGPGCDGQVLVMHDMLGLDSGHRRPKFVKDFL
AEGGSVAGAVQAYAQAVRDGSFPDAEHAYAA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccacgccgacagcaagccctggaccgtgcccgccttggcgcaggccaagcgc
gacggtcgaaaactggtcatgttgaccgcctatgacgccgggtttgcgcgcaccttcgac
gccaatggcgtggacctgatcctggtgggcgactcgctgggcatggtggtgcaggggcac
gagtccacgctgccagtgaccacggccgacatggtctaccacaccgccgcggtggcccgc
gtgctggagcgtgcgttgctggtggccgacttgtcgttccaggccgatgccacgccggaa
cgtgcgctcgatgccgccacccagctgctgcaggcgggtgcggagatggtcaagatcgaa
ggcgccgggcacaagctcgacgtgatccgctacctggttgagcgcgaaatcccggtgtgt
tcgcacctggggctcacgccgcaatcggtgctgcgcttcggcggctacaaggtgcaaggc
cgtggcgaagccggcgaacagctgcgtcgcgacgcccaggccgcggtcgatgccggtgcc
agcctgatcgtgctcgaatgcgtgccgacgccgatcgcagcgcagatcagcgccgagttg
cgcgtgcccacgatcggcattggtgccggccccggctgcgatggccaggtgctggtgatg
cacgacatgctgggcctggacagcggccatcgccgtcccaagttcgtcaaggatttcctg
gccgaaggcgggtcggtcgcgggcgccgtgcaggcctacgcgcaggccgtgcgcgatggc
agctttcccgacgccgagcacgcgtacgccgcatga

DBGET integrated database retrieval system