KEGG   Xanthomonas campestris pv. campestris 8004: XC_2469Help
Entry
XC_2469           CDS       T00247                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xcb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2986077..2986562)
Genome map
AA seq 161 aa AA seqDB search
MLTAFVGLGANLGQAEATVRAAIVALGTLPQSSVTAASRLYRTPAWGREDQPDFINAVAA
VRTALAPLALLDGLLAIEQAFGRDRRDGERWGPRTLDLDVLLYAEQVIDLPRLQVPHPHL
HARAFALVPLAELAPEAIIPGHGTVRHALQGVDGCGLEPIG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaccgcctttgtcggcctgggcgccaacctgggccaggccgaggccaccgtgcgc
gcggccatcgtcgcgctgggcacgctgccgcagtcgtcggtgaccgccgcttcgcggctg
taccgcacgccggcctggggccgtgaggaccagccggacttcatcaatgccgtggccgcc
gtgcgcactgcgctggcgccgctggcgctgctggacgggctgctggcgatcgagcaggca
ttcggccgcgaccgtcgcgacggcgagcgctggggcccgcgcaccctggatctggatgtg
ttgctgtatgccgagcaggtgatcgacctgccgcgtttgcaggtgccgcacccgcatctg
catgcccgtgcgtttgcgctggtgccgctggccgagctcgccccggaggcgatcattcca
gggcatggaacagtgcgacacgccctgcagggcgtcgatggctgtgggctggagccgatt
gggtag

DBGET integrated database retrieval system